KEGG   Pan paniscus (bonobo): 100974407
Entry
100974407         CDS       T02283                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin 2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04061  Viral protein interaction with cytokine and cytokine receptor
pps04144  Endocytosis
pps04151  PI3K-Akt signaling pathway
pps04630  JAK-STAT signaling pathway
pps04640  Hematopoietic cell lineage
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps05162  Measles
pps05166  Human T-cell leukemia virus 1 infection
pps05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100974407 (IL2RA)
   04151 PI3K-Akt signaling pathway
    100974407 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100974407 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100974407 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100974407 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100974407 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    100974407 (IL2RA)
   04659 Th17 cell differentiation
    100974407 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100974407 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100974407 (IL2RA)
   05162 Measles
    100974407 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100974407 (IL2RA)
   04090 CD molecules [BR:pps04090]
    100974407 (IL2RA)
Cytokine receptors [BR:pps04050]
 Interleukin receptor families
  IL2 receptor family
   100974407 (IL2RA)
CD molecules [BR:pps04090]
 Proteins
  100974407 (IL2RA)
SSDB
Motif
Pfam: Sushi TMEM100
Other DBs
NCBI-GeneID: 100974407
NCBI-ProteinID: XP_014201833
Position
10
AA seq 208 aa
MDSYLLMWGLLTLIMVPGCQAATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGH
CREPPPWENEATERIYHFVVGQTVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLIC
TGEMETSQFPGEEKPQASPEGRPESETSCLITTTDFQIQTEMAATMETFIFTTEYQVAVA
GCVFLLISVLLLSGLTWQRRQRKSRRTI
NT seq 627 nt   +upstreamnt  +downstreamnt
atggattcatacctgctgatgtggggactgctcacgctcatcatggtgcctggctgccag
gcagccactcggaacacaacgaaacaagtgacacctcaacctgaagaacagaaagaaagg
aaaaccacagaaatgcaaagtccaatgcagccagtggaccaagcgagccttccaggtcac
tgcagggaacctccaccgtgggaaaatgaagccacagagagaatttatcatttcgtggtg
gggcagacggtttactaccagtgcgtccagggatacagggctctacacagaggtcctgct
gagagcgtctgcaaaatgacccatgggaagacaaggtggacccagccccagctcatatgc
acaggtgaaatggagaccagtcagtttccaggtgaagagaagcctcaggcaagccccgaa
ggccgtcctgagagtgagacttcctgcctcatcacaacaacagattttcaaatacagaca
gaaatggctgcaaccatggagacgttcatatttacaacagagtaccaggtagcagtggcc
ggctgtgttttcctgctgatcagcgtcctcctcctgagtgggctcacctggcagcggaga
cagaggaagagtagaagaacaatctag

DBGET integrated database retrieval system