KEGG   Pan paniscus (bonobo): 100976110
Entry
100976110         CDS       T02283                                 

Gene name
STAM2
Definition
(RefSeq) signal transducing adaptor molecule 2
  KO
K04705  signal transducing adaptor molecule
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100976110 (STAM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100976110 (STAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100976110 (STAM2)
Membrane trafficking [BR:pps04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    100976110 (STAM2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT ENTH
Other DBs
NCBI-GeneID: 100976110
NCBI-ProteinID: XP_003832773
UniProt: A0A2R9BIG8
Position
2B
AA seq 525 aa
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGITFPPAGSQTVSAAAKNGTSSNKNKEEEDIAKAIELSLQE
QKQQHTETKSLYPSSEIQLNNKVARKVRALYDFEAVEDNELTFKHGEIIIVLDDSDANWW
KGENHRGIGLFPSNFVTTNLNIETEAVAVDKLNVIDDDVEEIKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALEL
YNKLVNEAPVYSVYSKLHPPAHYPPASSGVPMQTYPVQSHGGNYMGQSIHQVTVAQSYSL
GPDHIGPLRSLPPNVNSSVTAQPAQTSYLSTGQDTVSNPTYMNQNSNLQSATGTTAYTQQ
IGMSVDMSSYQNTTSNLPQLAGFPVTVPAHPVAQQHTNYHQQPLL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgcctttgttcaccgccaaccccttcgagcaagacgtggaaaaagccacgaatgagtac
aacactacagaagattggagtcttattatggacatatgtgacaaagttggaagtactcct
aatggagcgaaagattgcctaaaagccataatgaaaagggtaaatcataaggttccacat
gttgctctgcaagcactaactcttcttggggcttgtgtggcaaactgtggaaagatattt
catttagaagtatgttcccgtgattttgcaacagaagtacgtgctgtgattaaaaataag
gcacatcctaaagtatgtgaaaaactgaaatctttaatggtggagtggtcagaagaattt
cagaaggaccctcagtttagtctgatatctgcaactattaaatctatgaaagaagaagga
attacttttcctccagcaggttctcagactgtctcagctgctgccaagaatggtacgtca
tcgaacaaaaacaaagaggaagaagacatagctaaagctattgaattatcgctgcaagaa
cagaaacagcaacacacagaaacaaaatccttatatccatcttcagaaattcagttaaat
aataaggttgcacggaaagtgagagctttatatgattttgaagctgttgaggacaatgaa
ctcacctttaaacatggtgaaataattattgttttggatgacagtgatgccaattggtgg
aaaggagaaaatcacagaggaataggacttttcccatccaattttgtaacaactaattta
aacatagagactgaggcagtggctgtggacaaattgaatgtaattgatgatgatgtggag
gaaattaagaaatcagagcctgagcctgtttatatagatgaggataagatggatagagcc
ctgcaggtacttcagagtatagatccaacagattcaaaaccagactcccaagaccttttg
gatttagaagatatctgccaacagatgggtccaatgatagatgaaaaacttgaagaaatt
gataggaagcattcagaattgtctgaattgaatgttaaagtcctggaagctctggaacta
tataacaaattggtgaatgaagcaccagtgtactcagtctattcaaagctccaccctcca
gcacattacccacctgcatcatctggggttccaatgcagacatatccagttcaatcacat
ggtggaaactatatgggtcagagcattcaccaagtaactgttgcccaaagctatagccta
ggacccgatcacattggtccactgagatctctgcctccaaatgtgaattcctcagtgaca
gcacagcctgctcaaacttcatatttaagcactggacaagacactgtttccaatcctact
tatatgaaccagaactctaacctacagtcagctactggtacaactgcttacacacagcaa
atcgggatgtctgtggatatgtcatcttatcagaacactacttccaatttgcctcaactg
gcaggctttccggtgacagttccagctcatccagttgcacagcagcacacaaattaccat
cagcagcctctcctttag

KEGG   Pan paniscus (bonobo): 100991722
Entry
100991722         CDS       T02283                                 

Gene name
STAM
Definition
(RefSeq) signal transducing adaptor molecule
  KO
K04705  signal transducing adaptor molecule
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04144  Endocytosis
pps04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100991722 (STAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100991722 (STAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100991722 (STAM)
Membrane trafficking [BR:pps04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    100991722 (STAM)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 100991722
NCBI-ProteinID: XP_003831222
UniProt: A0A2R8ZKE2
Position
10
AA seq 540 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSNLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVY
SPPPAATAATATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgcctctttttgccaccaatcccttcgatcaggatgttgagaaagcaaccagcgagatg
aatactgctgaggactggggcctcattttggatatctgtgataaagttggtcagtctcgc
actggacctaaggattgtcttcggtctattatgagaagagtgaaccacaaagatcctcac
gttgctatgcaggctttgactcttctaggagcatgtgtatcaaactgtggcaaaattttt
catttagaagtatgttcaagagattttgctagtgaagtaagcaacgtattaaataagggt
catcctaaagtatgtgaaaaattaaaggctcttatggttgaatggacagatgaatttaag
aatgatccacagcttagtctaatatcagcaatgattaagaaccttaaggaacaaggagtt
acgttcccagctattggctctcaggctgcagaacaagcaaaagcaagcccagctcttgta
gccaaggatcctggtactgtggctaacaaaaaagaagaagaagatttagcaaaagccatt
gagttgtctctcaaggaacaaaggcagcagtcaaccaccctttccactttgtatccaagc
acatccaatctcttaactaaccaccaacatgaaggccgaaaagttcgtgctatatatgac
tttgaagctgctgaagacaatgaacttacttttaaagctggagaaattattacagttctt
gatgacagtgatcctaactggtggaaaggtgaaacccatcaaggcatagggttatttcct
tccaattttgtgactgcagatctcactgctgaaccagaaatgattaaaacagagaagaag
acggtacaatttagtgatgatgttcaggtagagacaatagaaccagagccggaaccagcc
tttattgatgaagataaaatggaccagttgctacagatgctgcaaagtacagaccccagt
gatgatcagccagacctaccagagctgcttcatcttgaagcaatgtgtcaccagatggga
cctctcattgatgaaaagctggaagatattgatagaaaacattcagaactctcagaactt
aacgtgaaagtgatggaggccctttccttatataccaagttaatgaacgaagatccgatg
tattccatgtatgcaaagttacagaatcagccatattatatgcagtcgtctggtgtttct
ggttctcaggtgtacgcagggccgcctccaagtggtgcctacctggttgcagggaacgcg
cagatgagccacctccagagctacagtcttcccccggagcagctgtcttctctcagccag
gcagtggtcccaccatccgcaaacccagcccttcctagtcagcagactcaggccgcttac
ccaaatacaatggtcagttctgttcaaggaaacacgtatcccagccaggcgccagtatat
agtcctcctcctgccgctactgctgctactgcaactgccgatgtcactctgtaccagaat
gcaggacctaatatgccccaggtgccaaactataacttaacatcatcaactctgcctcag
cccggaggcagccaacagccacctcagccacagcaaccatattctcagaaggctctgcta
tag

DBGET integrated database retrieval system