KEGG   Pan paniscus (bonobo): 100976438
Entry
100976438         CDS       T02283                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100976438 (ANKRD53)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100976438 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 100976438
NCBI-ProteinID: XP_003831002
UniProt: A0A2R8ZRC7
Position
2A
AA seq 530 aa
MASAGSTARRAGSGSWHSERGEGRGARPQPTPSGSMQQANKVSLKATWTDAESKQPSQPL
PDLADHLSAQATALATPRRPASFTPPRAEPSPSEESDQTAIDQTAIGSYYQLFAAAVGNV
EWLRFCLNQSLREIPTDDKGFTAIHFAAQWGKLACLQVLVEEYKFPVDLLTNNSQTPLHL
VIHRDNTTVALPCIYYLLEKGADLNAQTCNGSTPLHLAARDGLLDCVKVLVQSGANVHAQ
DAMGYKPIDFCKIWNHRACARFLKDAMWKKDKKDFAREMTKMKMFKSQLTLMEHNYLIEY
QKEHKVLREAAIRKWLHGKLHPGHSLVSNTKQARATALSKTPEQRESQRSRSFHPSVEAR
LQCIPQPTEMPKPIYRKPTVKRPTMWNVSNNPARPPTTQISHSQGIRLGVHPDPTPEHDF
SSFLEVRPDGHGGARLHTVDGHWVAPVPRLPFEVLLRMLCPRVWPYRMKVPQGFYPISMR
EVPRKRHLGDNTFWTDTLAMNLRDTFDEAFLAAVRSHQGLPTLHSPQTNP
NT seq 1593 nt   +upstreamnt  +downstreamnt
atggcctccgcgggcagcactgctcggcgggcgggctcgggaagctggcactcagaaagg
ggagaagggagaggtgctcggccgcagccaactccaagtggctccatgcagcaggcgaac
aaagtctccttgaaggccacctggactgacgcggagtccaagcagcccagccagcccctg
cccgacctcgcagaccacctcagtgcgcaggcgactgccctcgccacgccgcgccgccct
gcctcgttcaccccgccccgcgctgaacccagccccagcgaggagtccgaccagacggca
atcgaccagacggcgatcgggagctactaccagctgttcgcagcggctgtgggcaacgtg
gaatggctgcgattctgtctgaaccagagcctcagggaaatccccaccgacgacaagggc
ttcactgccatccacttcgccgcccaatggggcaagcttgcatgcctgcaggtcctggta
gaggagtacaagtttcccgtggacctgctgaccaacaatagccagacacccctgcacctc
gtcatccacagggacaacaccactgtggccctcccctgcatctactacctgctggagaaa
ggcgcagacctcaatgctcagacatgcaacggctccacgcccctgcacctggcagcccgt
gacggcttgctggactgtgtgaaggtcctggtgcagagtggcgccaacgtccatgcccaa
gatgccatgggctacaaacccattgacttctgcaaaatatggaaccaccgtgcctgtgcc
cggttcttgaaggatgccatgtggaaaaaggacaagaaggactttgcccgtgagatgacg
aaaatgaagatgttcaagagccagctgaccctcatggagcacaactacctgattgagtat
caaaaagagcacaaagttctcagagaagctgctatcagaaagtggctccacggcaagctg
cacccaggccactctctggtctccaataccaagcaagcccgggccaccgccctctccaag
accccagagcaacgggaatcgcagcgttccaggagcttccacccctctgtggaggcgcgt
ctgcaatgcattccacagcccacggagatgcccaagcccatctacaggaagcccacggtc
aagcggcccacgatgtggaatgttagcaacaaccccgccagaccccccaccacccagatc
agccactcgcagggcatccgcctgggcgtgcatccagaccccactccggagcacgacttc
agcagcttcctggaggtgaggcctgatgggcacggcggtgcgcggctgcacacagtggac
ggccactgggtggcgcccgtgccgcggctgccttttgaggtgctgctgcgcatgctgtgc
ccacgtgtatggccatacagaatgaaggtgccccagggcttttaccccatcagcatgagg
gaagtgcccaggaagcggcacctgggtgacaacaccttctggaccgacactctggccatg
aacctgcgtgacacattcgatgaagccttcctggcagctgtgcgatctcatcaaggactc
cccaccctgcactccccacaaaccaacccataa

DBGET integrated database retrieval system