KEGG   Pan paniscus (bonobo): 100978434
Entry
100978434         CDS       T02283                                 

Gene name
CLEC4M
Definition
(RefSeq) C-type lectin domain family 4 member M
  KO
K06563  C-type lectin domain family 4 member M
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04625  C-type lectin receptor signaling pathway
pps05152  Tuberculosis
pps05162  Measles
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100978434 (CLEC4M)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100978434 (CLEC4M)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100978434 (CLEC4M)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100978434 (CLEC4M)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100978434 (CLEC4M)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:pps04054]
    100978434 (CLEC4M)
   04090 CD molecules [BR:pps04090]
    100978434 (CLEC4M)
   04091 Lectins [BR:pps04091]
    100978434 (CLEC4M)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    100978434 (CLEC4M)
Pattern recognition receptors [BR:pps04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   100978434 (CLEC4M)
CD molecules [BR:pps04090]
 Proteins
  100978434 (CLEC4M)
Lectins [BR:pps04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    100978434 (CLEC4M)
SSDB
Motif
Pfam: Lectin_C DUF2170 Occludin_ELL GIT1_C Syntaxin_2 UL45 HARE-HTH DUF4795 DUF4763 DUF2357 DUF3422 Vps5 Med10 Tup_N
Other DBs
NCBI-GeneID: 100978434
NCBI-ProteinID: XP_003810043
Position
19
AA seq 307 aa
MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGPLVLQLLSFTL
LAGVLVAILVQVSKVPSSLSQEQSEQDTIYQNLTQLKAAVGELSEKSKLQEIYQELTQLK
AAVGELPEKSELQEIYQELTQLKAALGKLPDQSKQQQIYQELTDLKTAFERLCRHCPKDW
TFFQGNCYFMSNSQRNWHNSVTACREVRAQLVVIKSAEEQNFLQLQTSRSNRFSWMGLSD
LNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDIDNYWICKKP
AVCFRDE
NT seq 924 nt   +upstreamnt  +downstreamnt
atgagtgactccaaggaaccaagggtgcagcagctgggcctcctggaagaagatccaaca
accagtggcatcagactttttccaagagactttcaattccagcagatacatggccacaag
agctctacagggtgtcttggccatggtcccctggtgctgcaactcctctccttcacgctc
ttggctggggtcctggtggccatccttgtccaagtgtccaaggtccccagctccctaagt
caggaacaatccgagcaagacacaatctaccagaacctgacccagcttaaagctgcagtg
ggtgagctctcagagaaatccaagctgcaggagatctaccaggagctgacccagctgaag
gctgcagtgggtgagttgccagagaaatccgagctgcaggagatctaccaggagctgacc
cagctgaaggctgcacttggtaaattgccagaccagtccaagcagcagcaaatctatcaa
gaactgaccgatttgaagactgcatttgaacgcctgtgccgccactgtcccaaggactgg
acattcttccaaggaaactgttacttcatgtctaactcccagcggaactggcacaactcc
gtaaccgcctgccgggaagtgagggcccagctcgtcgtaatcaaaagtgctgaggagcag
aacttcctacagctgcagacttccagaagtaaccgcttctcctggatgggactttcagac
ctaaatcaggaaggcacgtggcaatgggtggacggctcacctctgtcacccagcttccag
cgatactggaacagtggagaacccaacaatagtgggaatgaagactgtgcggaatttagt
ggcagtggctggaacgacaatcgatgtgacattgacaattactggatctgcaaaaagccc
gcagtctgcttcagagacgaatag

KEGG   Pan paniscus (bonobo): 100979891
Entry
100979891         CDS       T02283                                 

Gene name
CD209
Definition
(RefSeq) CD209 molecule
  KO
K06563  C-type lectin domain family 4 member M
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04625  C-type lectin receptor signaling pathway
pps05152  Tuberculosis
pps05162  Measles
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100979891 (CD209)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100979891 (CD209)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100979891 (CD209)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100979891 (CD209)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100979891 (CD209)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:pps04054]
    100979891 (CD209)
   04090 CD molecules [BR:pps04090]
    100979891 (CD209)
   04091 Lectins [BR:pps04091]
    100979891 (CD209)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    100979891 (CD209)
Pattern recognition receptors [BR:pps04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   100979891 (CD209)
CD molecules [BR:pps04090]
 Proteins
  100979891 (CD209)
Lectins [BR:pps04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    100979891 (CD209)
SSDB
Motif
Pfam: Lectin_C DUF2170 Occludin_ELL DUF4795 GIT1_C Baculo_PEP_C DUF3422 DUF2730 Med10 DGCR6 DUF2357 Csm2_III-A
Other DBs
NCBI-GeneID: 100979891
NCBI-ProteinID: XP_003810049
UniProt: A0A2R9CP63
Position
19
AA seq 312 aa
MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLAGCLGHGPLVLQLLSFTLLAGLLVQV
SKVPSSISQEESRQDVIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKQ
QEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCRRCPWEWTFFQGNCYFMSN
SQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDG
SPLLPSFNQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFL
SPAPATPNPPPA
NT seq 939 nt   +upstreamnt  +downstreamnt
atgagtgactccaaggaaccaagactgcagcagctgggcctcctggaggaggaacagctg
agaggccttggattccgacagactcgaggctacaagagcttagcagggtgtcttggccat
ggtcccctggtgctgcaactcctctccttcacgctcttggctgggctccttgtccaagtg
tccaaggtccccagctccataagtcaggaagaatccaggcaagacgtgatctaccagaac
ctgacccagcttaaagctgcagtgggtgagctctcagagaaatccaagctgcaggagatc
taccaggagctgacccagctgaaggctgcagtgggtgagcttccagagaaatctaagcag
caggagatctaccaggagctgacccggctgaaggctgcagtgggtgagcttccagagaaa
tctaagcagcaggagatctaccaggagctgacccagctgaaggctgcagtggaacgcctg
tgccgccgctgcccctgggaatggacgttcttccaaggaaactgttacttcatgtctaac
tcccagcggaactggcacgactccatcactgcctgcaaagaagtgggggcccagctcgtc
gtaatcaaaagtgctgaggagcagaacttcctacagctgcagtcttccagaagtaaccgc
ttcacctggatgggactttcagatctaaatcaggaaggcacgtggcaatgggtggacggc
tcacctctgttgcccagcttcaaccagtattggaacagaggagagcccaacaacgttggg
gaggaagactgcgcggaatttagtggcaatggctggaacgacgacaaatgtaatcttgcc
aaattctggatctgcaaaaagtccgcagcctcctgctccagggatgaagaacagtttctt
tctccagcccctgccaccccaaacccccctcctgcgtag

KEGG   Pan paniscus (bonobo): 100990567
Entry
100990567         CDS       T02283                                 

Definition
(RefSeq) CD209 antigen-like protein 2
  KO
K06563  C-type lectin domain family 4 member M
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04145  Phagosome
pps04625  C-type lectin receptor signaling pathway
pps05152  Tuberculosis
pps05162  Measles
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100990567
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100990567
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100990567
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100990567
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100990567
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:pps04054]
    100990567
   04090 CD molecules [BR:pps04090]
    100990567
   04091 Lectins [BR:pps04091]
    100990567
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   C-lectin receptors
    100990567
Pattern recognition receptors [BR:pps04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   100990567
CD molecules [BR:pps04090]
 Proteins
  100990567
Lectins [BR:pps04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   DC-SIGN subgroup
    100990567
SSDB
Motif
Pfam: Lectin_C Swm2 BRICHOS
Other DBs
NCBI-GeneID: 100990567
NCBI-ProteinID: XP_008960617
UniProt: A0A2R9BX43
Position
19
AA seq 256 aa
MSDSKEPRVQLLGLLEEEELITSGMNFFPRNFGFRQTRGYKSLAGRLSHAPLVLLLLFFT
LFTGLLVAILVQGSKNPSSQRQEQSKQEEIFQDLSQLKAAVERLCRRCPWEWTFFQGNCY
FMSNSQRNWHDSITACQEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQ
WVDGSPLSSSFKQYWNRGEPNNIRKEDCVEFNGNGWNDDKCSAAKFWICKMSAASCSRDE
GQLLPSASVSPTAHAA
NT seq 771 nt   +upstreamnt  +downstreamnt
atgagtgactccaaggaaccaagggtgcagctgctgggcctcctggaagaggaagagctg
ataactagcggtatgaattttttcccgagaaactttggattccgacagactcgaggctac
aagagcttagcagggcgtctgagccacgcgcccctggtgctgctgctcctcttcttcaca
ctcttcactgggcttctggtggccatccttgtccaaggttccaagaaccccagctcccag
aggcaggagcagtccaagcaggaggagatcttccaggacctgtcccagctgaaggctgca
gtggaacgcctgtgccgccgctgcccctgggaatggacattcttccaaggtaactgttac
ttcatgtctaactcccagcggaactggcacgactccatcactgcctgccaagaagtgggg
gcccaactcgtcgtaatcaaaagtgctgaggagcagaacttcctacagctgcagtcttcc
agaagtaaccgcttcacctggatgggactttcagatctaaatcaggaaggcacgtggcaa
tgggtggacggctcacctctgtcatccagcttcaagcagtattggaacagaggagagcct
aacaatatcaggaaggaagactgtgtggaatttaacggcaatggctggaacgacgacaaa
tgcagtgctgccaaattctggatctgcaaaatgtctgcagcctcctgctccagagatgaa
gggcagcttctcccctcagcctctgtatccccgactgcccatgcagcatag

DBGET integrated database retrieval system