KEGG   Pan paniscus (bonobo): 100978943
Entry
100978943         CDS       T02283                                 

Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100978943
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     100978943
Peptidases and inhibitors [BR:pps01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   100978943
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 TSP1_spondin TSP1_CCN
Other DBs
NCBI-GeneID: 100978943
NCBI-ProteinID: XP_003822469
Position
9
AA seq 1130 aa
MRSLASTTAPTSSAAWPSAPRLSPCTFAREHLDMCQALSCHTDPLDQSSCSRLLIPLLDG
TECGVEKWCSKGRCRSLVELTPIAAVHGRWSSWGPQSPCSRSCGGGVVTRRRQCNNPRPA
FGGRACVGADLQAEMCNTQACEKTQLEFMSEQCARTDSQPLRSSPGGASFYHWGAAVPHS
QGDALCRHMCRAIGESFIMKRGDSFLDGTRCMPSGPREDGTLSLCVSGSCRTFGCDGRMD
SQQVWDRCQVCGGDNSTCSPRKGSFTAGRAREYVTFLTVTPNLTSVYIANHRPLFTHLAV
RIGGRYVVAGKMSISPNTTYPSLLEDGRVEYRVALTEDRLPHLEEIRIWGPLQEDADIQV
YRRYGEEYGNLTRPDITFTYFQPKPRQAWVWAAVRGPCSVSCGAGLRWVNYSCLDQARKE
LVETVQCQGSQQPPAWPEACVLEPCPPYWAVGDFGPCSASCGGGLRERPVHCVEAQGSLL
KTLPPARCRAGAQQPAVALETCNPQPCPARWEVSEPSSCASAGGAGLALENETCVPGADG
LEAPVTEGPGSVDEKLPAPEPCVGMSCPPGWGHLDATSAGEKAPSPWGSIRTGAQAAHVW
TPVAGSCSVSCGRGLMELCFLCMDSALRVPVQEELCGLASKPGSRREVCQAVPCPARWRY
KLAACSVSCGGGVVRRILYCARAHGEDDGEEILLDTQCQGLPRPEPQEACSLEPCPPRWK
VMSLGPCSASCGLGTARRSVACVQLDQGQDVEVDEAACVALVRPQASVPCLTADCTYRWH
VGTWMECSVSCGDGIQRRRDTCLGPQVQAPVPADFCQHLPKPVTVRGCWAGPCVGQGTPS
LVPHEEAAAPGRTTATPAGASLEWSQARALLFSPAPQPRRLLPGPQENSVQSSACGRQHL
EPTGTIDMRGPGQADCAVAIGRPLGEVVTLRVLESSLNCSAGDMLLLWGRLTWRKMCRKL
LDMTFSSKTNTLVVRQRCGRPGGGVLLRYGSQLAPETFYRECDMQLFGPWGEIVSPSLSP
ATSNAGGCRLFINVAPHARIAIHALATNMGAGTEGANASYISIRDTHSLRTTAFHGQQVL
YWESESSQAEMEFSEGFLKAQASLRGQYWTLQSWVPEVQDPQSWKGKEGT
NT seq 3393 nt   +upstreamnt  +downstreamnt
atgcgcagcctggcctctactacagcgccaacgagcagtgccgcgtggccttcggcccca
aggctgtcgccgtgcaccttcgccagggagcacctggatatgtgccaggccctctcctgc
cacacagacccgctggaccaaagcagctgcagccgcctcctcattcctctcctggatggg
acagaatgtggcgtggagaagtggtgctccaagggtcgctgccgctccctggtggagctg
acccccatagcagcagtgcatgggcgctggtctagctggggtccccaaagtccttgctcc
cgctcctgtggaggaggtgtggtcaccaggaggcggcagtgcaacaaccccagacctgcc
tttggggggcgtgcatgtgttggtgctgacctccaggccgagatgtgcaacactcaggcc
tgcgagaagacccagctggagttcatgtcggaacagtgtgccaggaccgacagccagccg
ctgcgctcctcccctggcggtgcctccttctaccactggggtgctgctgtaccacacagc
caaggggatgctctgtgcagacacatgtgccgggccattggcgagagcttcatcatgaag
cgtggagacagcttcctcgatgggacccggtgtatgccaagtggcccccgggaggacggg
accctgagcctgtgtgtgtcgggcagctgcaggacatttggctgtgacggcaggatggac
tcccagcaggtatgggacaggtgccaggtgtgtggtggggacaacagcacgtgcagccca
cggaagggctctttcacagctggcagagcgagagaatatgtcacatttctgacagttacc
cccaacctgaccagtgtctacattgccaaccacaggcctctcttcacacacttggcggtg
aggattggagggcgctatgtcgtggctgggaagatgagcatctcccctaacaccacctac
ccctccctcctggaggatggtcgtgtcgagtacagagtggccctcaccgaggaccggctg
ccccacctggaggagatccgcatctggggacccctgcaggaagatgctgacatccaggtt
tacaggcggtatggcgaggagtatggcaacctcacccgcccagacatcaccttcacctac
ttccagcctaagccacggcaggcctgggtgtgggccgctgtgcgtgggccctgctcggtg
agctgtggggcagggctgcgctgggtaaactacagctgcctggaccaggccaggaaggag
ttggtggagacagtccagtgccaagggagccagcagccaccagcgtggccagaggcctgc
gtgctcgaaccctgccctccctactgggcggtgggagacttcggcccatgcagcgcctcc
tgtgggggcggcctgcgggagcggccagtgcactgcgtggaggcccagggcagcctcctg
aagacattgcccccagcccggtgcagagcaggggcccagcagccagctgtggcgctggaa
acctgcaacccccagccctgccctgccaggtgggaggtgtcagagcccagctcatgcgca
tcagctggtggagcaggcctggccttggagaacgagacctgtgtgccaggggcagatggc
ctggaggctccagtgactgaggggcctggctccgtagatgagaagctgcctgcccctgag
ccctgtgttgggatgtcatgccctccaggctggggccatctggatgccacctctgcaggg
gagaaggctccctccccatggggcagcatcaggacgggggctcaagctgcacacgtgtgg
acccctgtggcggggtcgtgctccgtctcctgcgggcgaggtctgatggagctgtgtttc
ctgtgcatggactctgccctcagggtgcctgtccaggaagagctgtgtggcctggcaagc
aagcctgggagccggcgggaggtctgccaggctgtcccgtgccctgctcggtggcggtac
aagctggcggcctgcagcgtgagctgtgggggaggggtcgtgcggaggatcctgtattgt
gcccgggcccatggggaggatgatggtgaggagatcctgttggacacccagtgccagggg
ctgcctcgcccggaaccccaggaggcctgcagcctggagccctgccctcctaggtggaaa
gtcatgtcccttggcccatgttcggccagctgtggccttggcactgctagacgctcggtg
gcctgtgtgcagctcgaccaaggccaggacgtggaggtggatgaggcggcctgtgtggcg
ctggtgcggccccaggccagtgtcccctgtctcactgccgactgcacctaccgctggcat
gttggcacctggatggagtgctctgtttcctgtggggatggcatccagcgccggcgtgac
acctgcctcggaccccaggtccaggcgcctgtgccggctgatttctgccagcacttgccc
aagccggtgactgtgcgtggctgctgggctgggccctgtgtgggacagggtacgcccagc
ctggtgccccacgaagaagccgctgctccaggacggaccacagccacccctgctggtgcc
tccctggagtggtcccaggcccgggccctgctcttctccccggctccccagcctcggcgg
ctcctgcccgggccccaggaaaactcagtgcagtccagtgcctgtggcaggcagcacctt
gagccaacaggaaccattgacatgcgaggcccagggcaggcagactgtgcagtggccatt
gggcggcccctcggggaggtggtgaccctccgcgtccttgagagttctctcaactgcagt
gcgggggacatgttgctgctctggggccggctcacctggaggaagatgtgcaggaagctg
ttggacatgactttcagctccaagaccaacacgctggtggtgaggcagcgctgcgggcgg
ccaggaggtggggtgctgctgcggtatgggagccagcttgctcctgaaaccttctacaga
gaatgtgacatgcagctctttgggccctggggtgaaatcgtgagcccctcgctgagtcca
gccacgagtaatgcagggggctgccggctcttcattaatgtggctccgcacgcacggatt
gccatccatgccctggccaccaacatgggcgctgggaccgagggagccaatgccagctac
atctcgatccgggacacccacagcttgaggaccacagcgttccatgggcagcaggtgctc
tactgggagtcagagagcagccaggctgagatggagttcagcgagggcttcctgaaggct
caggccagcctgcggggccagtactggaccctccaatcatgggtaccggaggtgcaggac
cctcagtcctggaagggaaaggaaggaacctga

DBGET integrated database retrieval system