KEGG   Pan paniscus (bonobo): 100980170Help
Entry
100980170         CDS       T02283                                 

Gene name
WDR62
Definition
(RefSeq) WD repeat domain 62
  KO
K21762  WD repeat-containing protein 62
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pps03036]
    100980170 (WDR62)
Chromosome and associated proteins [BR:pps03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100980170 (WDR62)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A DUF5046
Motif
Other DBs
NCBI-GeneID: 100980170
NCBI-ProteinID: XP_003816137
UniProt: A0A2R8ZWE3
Position
19
AA seq 1523 aa AA seqDB search
MAAVGSGGYARNDAGEKLPSVMAGVPARRGQSSPPPAPPICLRRRTRLSTASEETVQNRV
SLEKVLGITAQNSSGLTCDPSTGHVAYLAGCVVVILDPKENKQQHIFNTARKSLSALAFS
PDGKYIVTGENGHRPAVRIWDVEEKNQVAEMLGHKYGVACVAFSPNMKHIVSMGYQHDMV
LNVWDWKKDIVVASNKVSCRVIALSFSEDSSYFVTVGNRHVRFWFLEVSTETKVTSTVPL
VGRSGILGELHNNIFCGVACGRGRMAGSTFCVSYSGLLCQFNEKRVLEKWINLKVSLSSC
LCVSQELIFCGCTDGIVRIFQAHSLHYLANLPKPHYLGVDVAQGLEPSFLFHRKAEAVYP
DTVALTFDPIHQWLSCVYKDHSIYIWDVKDINGVGKVWSELFHSSYVWNVEVYPEFEDQR
ACLPSGSFLTCSSDNTIRFWNLDSSPDSHWQKNIFSNTLLKVVYVENDIQHLQDMSHFPD
RGSENGTPMDVKAGVRVMQVSPDGQHLASGDRSGNLRIHELHFMDELVKVEAHDAEVLCL
EYSKPETGLTLLASASRDRLIHVLNVEKNYNLEQTLDDHSSSITAIKFAGNRDIQMISCG
ADKSIYFRSAQQGSDGLHFVRTHHVAEKTTLYDMDIDITQKYVAVACQDRNVRVYNTVNG
KQKKCYKGSQGDEGSLLKVHVDPSGTFLATSCSDKSISVIDFYSGECIAKMFGHSEIITS
MKFTYDCHHLITVSGDSCVFIWHLGPEITNCMKQHLLEIDHRQQQQHTNDKKRSGHPRQD
TYVSTPSEIRSLSPGEQTEDDLEEECEPEEMLKTPSKDSLDPDPRCLLTNGKLPLWAKRL
LGDDDVADGSAFHAKRSYQPHGRWAERAGQEPLKTILDAQDLDCYFTPMKPESLENSILD
SLEPQSLASLLSESESPQEAGRGHPSFLPQQKESSEASELILYSLEAEVTVTGTDSQYCR
KEVEAGPGDQQGDSYLRVSSDSPKDQSPPEDSGESEADLECSFAAIHSPAPPPDPAPRFA
TSLPHFPGCAGPTEDELSLPEGPSVPSSSLPQTPEQEKFLRHHFETLTESPCRELFPAAL
GDVEASEAEDYFFNPRLSISTQFLSSLQKASRFTHTFPPRATQCLVKSPEVKLMDRGGSQ
PRAGTGYASPDSTHVLAAGKAEETLEAWHPPPPCLTSLASCVPASSVLPTDRNLPTPTSA
PTPGLAQGVHAPSTCSYMEATASSRARISRSISLGDSEGPIVATLAQPLRRPSSVGELAS
LGQELQAITTATPPSLDSEGQEPALRSWGNHEARANLRLTLSSVCDGLLLPPVDTQPGVT
VPAVSFPAPSPVEESALRLHGSAFHPSLPAPESPGLPAHPSNPQLPEAGPGVPGGTASLL
EPTSGALGLFQGSPARWSEPWVPVEALSPSPLELSRVGNILHRLQTTFQEALDLYRVLVS
SGQVDTGQQQARTELVSTFLWIHSQLEAECLVGTSVAPAQALPSPGPPTPPTLYPLASPD
LQALLEHYSELLVQAVRRKARGH
NT seq 4572 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgtagggtccggaggctatgcgcggaacgatgcaggggagaagctgccctct
gtcatggcgggagttccggcgcggaggggccagtcctccccgccccccgccccaccaatc
tgcctacggcggcggacgcgactctcgacggcctccgaggagacggtgcagaaccgggtg
tcactcgagaaggtgcttggcatcacagcccagaacagcagtggcctaacctgtgacccc
agcacaggccatgtggcctacctggcaggctgtgtggtggtgattttggaccccaaggag
aacaagcagcagcacatctttaacaccgccaggaagtctctcagtgctctggccttctcc
cctgatgggaagtacatagtgacaggggagaatgggcataggcctgctgtgcgcatctgg
gatgtggaggagaagaatcaggtggcggagatgctaggccacaagtatggtgtggcgtgt
gtggccttctcacccaatatgaagcacatcgtgtccatgggctaccaacatgacatggtg
ctcaacgtctgggactggaagaaagacatcgtagtggcctccaacaaggtatcttgtaga
gtcattgccctctccttctcagaggacagcagctattttgtcactgttgggaaccggcat
gtgaggttctggttcttggaagtctccactgagacaaaggtgacgagcacagtgcccctt
gtagggcgctcgggcatcctgggcgagctgcacaacaacatcttctgtggtgtggcctgc
ggtcggggccggatggcgggcagtaccttctgtgtgtcctactcgggcctcctctgccag
ttcaatgagaagagggtgctggagaagtggatcaacctgaaggtctccctgtcttcctgc
ctctgtgtcagccaggagctcatcttctgtggctgcacagatgggatagtccgcatcttc
caggcccatagcctgcactacctcgccaacctgcccaagccacactaccttggggtagac
gtggcacagggcctggagcccagcttcctcttccacaggaaggcggaagcagtctaccca
gatacagtggcactgaccttcgaccccatccaccagtggctgtcctgcgtgtataaggac
cacagcatctacatctgggatgtcaaggacatcaacggagtgggcaaggtgtggtcagag
ctcttccacagctcctacgtttggaacgtggaggtgtatcctgagtttgaagaccagaga
gcttgtttgccatcaggatcctttctgacttgttcttcagacaacaccattcgcttctgg
aacttggacagcagccctgattctcactggcagaaaaacatcttcagcaataccctgctg
aaggtcgtgtacgtggagaatgacatccagcacctgcaggacatgtcacacttcccagac
cgagggagcgagaatgggacacccatggacgtgaaagccggggtgcgggtcatgcaggtc
agtcctgacggccagcatttggcttcaggcgaccgaagtggaaatctgaggatccacgag
ctgcacttcatggacgagctggtcaaggtggaggcccatgatgctgaggtgctgtgcctg
gagtactccaagccagagacggggctgaccttgctggcctcagccagtcgggaccggctg
atccatgtgctgaacgtggagaagaactacaacctggagcagacgctggatgaccactcc
tcctccatcaccgccatcaagttcgctggcaacagagacatccagatgatcagctgtggg
gctgacaagagcatctactttcgcagtgcccagcagggttcggatggactacactttgtc
cgtacccaccacgtagcagagaaaaccaccttgtatgacatggacattgacatcacccag
aagtacgtggccgtggcctgccaggaccgcaatgtgagagtctacaacactgtgaacggg
aagcagaagaagtgctacaagggctcccagggtgacgaagggtccttgctgaaggtccat
gtggacccctcaggcaccttcctggccaccagctgctctgacaaaagcatctcagtgatt
gacttttactcgggcgagtgcattgccaagatgtttggccattcagaaattattaccagc
atgaagttcacctatgactgtcatcacttgatcacagtatctggagacagctgcgtgttc
atctggcacctgggcccggagatcaccaactgcatgaagcagcacttgctggagattgac
caccggcagcagcagcagcacacaaatgacaagaagcggagcggccaccccaggcaggat
acgtatgtgtccacacctagtgagattcgctccctgagccctggagagcaaacagaggat
gatctggaggaagagtgtgagccagaagagatgctgaagacaccatccaaagatagcttg
gatccagatcctcgttgcctgctaaccaacggcaagctgccactgtgggcaaagcggctg
ctaggggacgatgatgtggcagatggctcggccttccacgccaagcgcagctaccagccc
cacggccgctgggcagagcgggccggccaagagcccctcaagaccatcctggatgcccag
gacctggattgctactttacccccatgaagcccgagagtctggagaactccattctggat
tcactggagccacagagcctggccagcctgctgagtgagtcagagagtccccaggaagct
ggccgcgggcacccctccttcctgccccagcagaaggaatcatctgaggccagtgagctc
atcctctactctctggaggcagaagtgacagtcacagggacagacagccagtattgcagg
aaggaggtggaggccgggcctggagaccagcagggcgactcctacctcagggtgtcctcc
gacagcccaaaggaccagagcccgcctgaggactcgggggagtcagaggccgacctggag
tgcagcttcgcagccatccactccccagctccgcctcctgaccctgcccctcggtttgcc
acgtcactgccccatttcccaggatgcgcaggtcccacagaagatgagctgtccctgccc
gagggacccagcgtccccagcagctccctaccccagactccggagcaggagaagttcctc
cgccaccactttgagacactgactgagtccccctgcagagagctcttccccgcagctctg
ggagacgtggaggcctctgaagctgaagactacttcttcaacccacgcctgagcatctcc
acgcagttcctctcaagcctccagaaggcatccaggttcacccataccttccctccccgg
gcaacccagtgccttgtgaaatctccagaggtcaagctcatggaccgaggcggaagccag
cccagagcaggtactggctacgcctccccagacagtacccacgtcctcgctgcagggaag
gctgaagagaccctggaggcctggcacccaccacctccctgccttacgagcctggcgtcc
tgtgtccctgcttcctccgtgctgcccacagacaggaatctcccaacgcccacatctgca
cccaccccaggcctggctcagggtgtccatgccccctccacctgttcctacatggaggcc
actgccagctcccgtgccaggatatcacgcagcatctccctcggtgacagtgagggccct
atcgtggccacactggcccagcccctccgtaggccatcgtccgttggggagctggcctcc
ttgggccaggagcttcaggccatcaccaccgcaacaccacccagtttggacagtgagggc
caagagcctgccctgcgttcctggggcaaccacgaggcccgggccaacctgagactgacc
ctgtcaagtgtctgtgatgggctcctgctgccccccgtggatacccagcctggcgtcacc
gtccctgcagtgagcttcccagcccctagccctgtggaagagagcgccctgaggctccac
ggctctgcctttcacccaagtctcccagctcctgagtcccctggccttcctgcccacccc
agtaacccccagcttccagaggccgggcctggcgtccctggcggcactgcctccctcctg
gagcccacctccggtgcacttggtctgttccagggcagccctgcccgctggagtgagccc
tgggtgccggttgaagccctgtccccatctccccttgagctgagcagggtggggaacatc
ttgcacaggctgcagaccaccttccaagaagccctcgacctttaccgtgtgttggtctcc
agtggccaggtggacaccgggcagcagcaggcacggactgagctggtctccaccttcctg
tggatccacagccagctggaggctgaatgcctggtggggactagtgtggccccagcccag
gctctgcccagcccaggacccccgaccccaccgacgctgtaccccctggccagcccagac
ctgcaggccctgctggaacactactcggagctgctggtgcaggccgtgcggaggaaggca
cgggggcactga

DBGET integrated database retrieval system