KEGG   Pan paniscus (bonobo): 100981917Help
Entry
100981917         CDS       T02283                                 

Gene name
ZNF689
Definition
(RefSeq) zinc finger protein 689
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
pps  Pan paniscus (bonobo)
Pathway
pps05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:pps00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100981917 (ZNF689)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100981917 (ZNF689)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    100981917 (ZNF689)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf_UBZ zf-C2H2_jaz Zn-ribbon_8 zf-met zf-C2H2_6 zf-C2H2_11 zf-C2HC_2 DUF3268
Motif
Other DBs
NCBI-GeneID: 100981917
NCBI-ProteinID: XP_003807519
UniProt: A0A2R9ATC2
Position
16
AA seq 500 aa AA seqDB search
MAPPSAPLPAQGPGKARPSRKRGRRPRALKFVDVAVYFSPEEWGCLRPAQRALYRDVMRE
TYGHLGALGCAGPKPALISWLERNTDDWEPAALDPQEYPRGLTVQRKSRTRKKNGEKEVF
PPKEAPRKGKRGRRPSKPRLIPRQTSGGPICPDCGCTFPDHQALESHKCAQNLKKPYPCP
DCGRRFSYPSLLVSHRRAHSGECPYVCDQCGKRFSQRKNLSQHQVIHTGEKPYHCPDCGR
CFRRSRSLANHRTTHTGEKPHQCPSCGRRFAYPSLLAIHQRTHTGEKPYTCLECNRRFRQ
RTALVIHQRIHTGEKPYPCPDCERRFSSSSRLVSHRRVHSGERPYACEHCEARFSQRSTL
LQHQLLHTGEKPYPCPDCGRAFRRSGSLAIHRSTHTEEKLHACDDCGRRFAYPSLLASHR
RVHSGERPYACDLCSKRFAQWSHLAQHQLLHTGEKPFPCLECGRCFRQRWSLAVHKCSPK
APNCSPRSAIGGSSQRGNAH
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgccaccttcggctccgctccctgcgcagggaccaggaaaggccagacccagtcgg
aaaaggggcaggaggccgagggctctgaagttcgtggacgtggccgtgtacttctccccg
gaggagtggggctgcctgcggcccgcgcagagggccctgtaccgggacgtgatgcgggag
acctacggtcacctgggcgcgctcgggtgcgcaggtcccaaaccagccctcatctcctgg
ttggaacgaaacaccgatgactgggaaccggctgctctagatccgcaggagtacccgaga
gggctaacagtccagagaaaaagcagaaccagaaagaagaatggggagaaggaagtattc
ccgcctaaggaggcaccccgaaaggggaagcgaggccggaggcccagcaaaccccgactg
attcccaggcagacgtccgggggccccatctgccctgactgcggctgtaccttccctgat
catcaggccctggagagccacaagtgcgcccagaatctaaaaaagccttacccttgccca
gactgtgggcgccgcttttcctatccatccctgctggtcagtcaccggcgggcacactcc
ggcgagtgcccctatgtttgtgaccagtgtggcaaacgtttctcccagcgcaagaacctc
tcccagcaccaggtcatccatacaggggagaagccctatcactgccctgactgtggtcgc
tgcttccggaggagccggtccttggccaatcaccggaccacacacacaggcgaaaaaccc
caccagtgccctagctgtggacgtcgcttcgcctacccctccctgctagccatccaccag
cgtacacacacgggagagaagccctacacttgcctcgagtgcaaccgccgcttccgccag
cgcacggccctcgtcatccaccagcgcatccacacgggcgagaagccctacccgtgcccg
gactgcgagcggcgcttctcctcctcctctcgcctggtcagtcaccggcgtgtgcactcc
ggggagcgtccctatgcctgtgagcactgtgaggcccgcttctcccagcgcagcacgctg
ctccagcaccagctcttgcacaccggagagaagccctacccctgcccagattgtgggcgt
gccttccggcggagcggctccctggccatccatcgcagcacgcacacagaggagaagctg
cacgcctgcgacgactgtggtcgccgctttgcctacccctcactgctggccagccaccgg
cgcgtgcactcgggcgagcggccctatgcctgcgacctttgctccaagcgttttgctcag
tggagccacctggcccagcaccagctgctgcacacgggggagaagcctttcccctgcctc
gagtgtggccggtgcttccgccagaggtggtctctggctgtccacaagtgtagccccaag
gccccaaactgtagccctagatctgctatcgggggctccagtcagaggggcaacgcccat
tag

DBGET integrated database retrieval system