KEGG   Pan paniscus (bonobo): 100982432
Entry
100982432         CDS       T02283                                 

Gene name
C3
Definition
(RefSeq) complement C3
  KO
K03990  complement component 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04080  Neuroactive ligand-receptor interaction
pps04145  Phagosome
pps04610  Complement and coagulation cascades
pps04613  Neutrophil extracellular trap formation
pps05133  Pertussis
pps05134  Legionellosis
pps05140  Leishmaniasis
pps05142  Chagas disease
pps05150  Staphylococcus aureus infection
pps05152  Tuberculosis
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05203  Viral carcinogenesis
pps05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100982432 (C3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100982432 (C3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100982432 (C3)
   04613 Neutrophil extracellular trap formation
    100982432 (C3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100982432 (C3)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100982432 (C3)
   05168 Herpes simplex virus 1 infection
    100982432 (C3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100982432 (C3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100982432 (C3)
   05134 Legionellosis
    100982432 (C3)
   05150 Staphylococcus aureus infection
    100982432 (C3)
   05152 Tuberculosis
    100982432 (C3)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100982432 (C3)
   05142 Chagas disease
    100982432 (C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    100982432 (C3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pps01002]
    100982432 (C3)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100982432 (C3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pps04147]
    100982432 (C3)
Peptidases and inhibitors [BR:pps01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   100982432 (C3)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Phagocytosis
   Opsonins
    100982432 (C3)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100982432 (C3)
SSDB
Motif
Pfam: TED_complement A2M A2M_recep MG1 MG4 NTR MG2 A2M_BRD ANATO MG3
Other DBs
NCBI-GeneID: 100982432
NCBI-ProteinID: XP_003819440
Position
19
AA seq 1543 aa
MGPTSGPSLLLLLLTHLPLALGSPMYSIITPNILRLESEETVVLEAHDAQGDVPVTVIVH
DFPGKKLVLSSEKTVLTPATNHMGNVTFMIPANREFKSEKGRNKFVTVQATFGAQVVEKV
VLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSL
SSQNQFGILPLSWDIPELVNMGQWKIQAYYENSPQEVFSAEFEVKEYVLPSFEVIVEPTE
KFYYIYNEKGLEVTITARSLHSQLVPSGSDMVQAERSGIPIVTSPYQIHFTKTPKYFKPG
MPFDLMVFVTNPDGSPAYRVPVAVQGEDTVQSLTQGDGVAKLSINTHPSQKPLSITVRTK
KQELSEAEQATSTMQALPYSTVGNSNNYLHLSVPRTELRPGETLNVNFLLRMDRAHEAKI
RYYTYLIMNKGRLLKAGRQVREPGQDLVVLPLSITTDFIPSFRLVAYYTLIGASGQREVV
ADSVWVDVKDSCVGSIWDVVEKADIGCTPGSGKDYAGVFSDAGLTFTSSSGQQTAQRAEL
QCPQPAARRRRSVLLTEKRMDKVGKYPKELRKCCEDGMRENPMRFSCQRRTRFISLGEAC
KKVFLDCCNYITELRRQHARAGHLGLARSDLDEDIIAEENIVSRSEFPESWLWNVEDLKE
PPKNGISTKLMNIFLKDSITTWEILAVSMSDKKGICVADPFEVTVMQDFFIDLRLPYSVV
RNEQVEIRAVLYNYRQNQELKVRVELLHNPAFCSLATTKRRHQQTVTIPPKSSLSVPYVI
VPLKTGLQEVEVKAAVYHHFISDGVRKSLKVVPEGIRMNKTVAVRTLDPERLGREGVQKE
DIPPADLSDQVPDTESETRILLQGTPVAQMTEDAVDAERLKHLIVTPSGCGEQNMIGMTP
TVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTA
YVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKD
MALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMG
RLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQR
YYGGGYGSTQATFMVFQALAQYQKDVPDHKELNLDVSLQLPSRSSKITHRIHWESASLLR
SEETKENEGFTVTAEGKGQGTLSVVTMYHAKAKDQLTCNKFDLKVTIKPAPETEKRPQDA
KNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLASGVDRYISKYELDKAFSD
RNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLAESCTRFYHPEKEDG
KLNKLCRDELCRCAEENCFIQKSDDKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDE
YIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSY
IIGKDTWVEHWPEEDECQDEENQQQCQDLGAFTESMVVFGCPN
NT seq 4632 nt   +upstreamnt  +downstreamnt
atgggacccacctcaggtcccagcctgctgctcctgctactaacccacctccccctggct
ctggggagtcccatgtactctatcatcacccccaacatcttgcggctggagagcgaggag
accgtggtgctggaggcccacgacgcgcaaggggatgttccagtcactgttattgtccac
gacttcccaggcaaaaaactagtgctgtccagtgagaagaccgtgctgacccctgccacc
aaccacatgggcaacgtcaccttcatgatcccagccaacagggagttcaagtcagaaaag
gggcgcaacaagttcgtgaccgtgcaggccaccttcggggcccaagtggtggagaaggtg
gtgctggtcagccttcagagtgggtacctcttcatccagacagacaagaccatctacacc
cctggctccacagttctctatcggatcttcaccgtcaaccacaagctgctacccgtgggc
cggacggtcatggtcaacattgagaacccggaaggcatcccggtcaagcaggactccttg
tcttctcagaaccagtttggcatcttgcccttgtcttgggacattccggaactcgtcaac
atgggccagtggaagatccaagcctactatgaaaactcaccacaggaggtcttctccgct
gagtttgaggtgaaggagtacgtgctgcccagtttcgaggtcatagtggagcctacagag
aaattctactacatctataacgagaagggcctggaggtcaccatcaccgccaggagccta
cactcacagctggtcccctcaggcagtgacatggtgcaggcagagcgcagcgggatcccc
atcgtgacctctccctaccagatccacttcaccaagacacccaagtacttcaaaccagga
atgccctttgacctcatggtgttcgtgacgaaccccgatggctctccagcctaccgagtc
cctgtggcagtccagggcgaggacactgtgcaatctctaacccagggagacggcgtggcc
aaactcagcatcaacacacaccccagccagaagcccttgagcatcacggtgcgcacgaag
aagcaggagctctcggaggcagagcaggctaccagcaccatgcaggctctgccctacagc
accgtgggcaactccaacaattacctgcatctctcagtgccacgtacagagctcagaccc
ggggagaccctcaacgtcaacttcctcctgcgaatggaccgcgcccacgaggccaagatc
cgctactacacctacctgatcatgaacaagggcaggctgttgaaggcgggacgccaggtg
cgagagcccggccaggacctggtggtgctgcccctgtccatcaccaccgacttcatccct
tccttccgcctggtggcgtactacacgctgatcggcgccagcggccagagggaggtggtg
gccgactccgtgtgggtggacgtcaaggactcctgcgtgggctcgatctgggacgtggtg
gagaaggcagacatcggctgcaccccgggcagtgggaaggattacgccggtgtcttctcc
gacgcagggctgaccttcacgagcagcagtggccagcagaccgcccagagggcagaactt
cagtgcccgcagccagccgcccgccgacgccgttccgtgctgctcacggagaagcgaatg
gacaaagtcggcaagtaccccaaggagctgcgcaagtgttgcgaggacggcatgcgggag
aaccccatgaggttctcgtgccagcgccggacccgtttcatctccctgggcgaggcgtgc
aagaaggtcttcctggactgctgcaactacatcacagagctgcggcggcagcacgcgcgg
gccggccacctgggcctggccagaagtgacctggatgaggacatcattgcagaagagaac
atcgtttcccgaagcgagttcccagagagctggctgtggaacgttgaggacttgaaagag
ccaccgaaaaatggaatctctacaaagctcatgaatatatttttgaaagactccatcacc
acgtgggagattctggctgtgagcatgtcggacaagaaagggatctgtgtggcagacccc
ttcgaggtcacagtaatgcaggacttcttcatcgacctgcggctaccctactctgttgtt
cgaaacgagcaggtggaaatccgagccgttctctacaattaccggcagaaccaagagctc
aaggtgagggtggaactactccacaatccagccttctgcagcctggccaccaccaagagg
cgtcaccagcagaccgtaaccatcccccccaagtcctcgttgtccgttccttatgtcatc
gtgccgctaaagaccggcctgcaggaagtggaagtcaaggctgccgtctaccatcatttc
atcagtgacggtgtcaggaagtccctgaaggtcgtgccggaaggaatcagaatgaacaaa
actgtggctgttcgcaccctggatccagaacgcctgggccgtgaaggagtgcagaaagag
gacatcccacctgcagacctcagtgaccaagtcccggacactgagtctgagaccagaatt
ctcctgcaagggaccccagtggcccagatgacagaggatgccgtcgacgcggaacggctg
aagcacctcattgtgaccccctcgggctgcggggaacagaacatgatcggcatgacgccc
acggttatcgctgtgcattacctggatgaaacggagcagtgggagaagttcggcctagag
aagcggcagggggccttggagctcatcaagaaggggtacacccagcagctggccttcaga
caacccagctctgcctttgcggccttcgtgaaacgggcacccagcacctggctgaccgcc
tacgtggtcaaggtcttctctctggctgtcaacctcattgccatcgactcccaagtcctc
tgcggggctgttaaatggctgatcctggagaagcagaagcccgacggggtcttccaggag
gatgcgcccgtgatacaccaagaaatgattggtggattacggaacaacaacgagaaagac
atggccctcacggcctttgttctcatctcgctgcaggaggctaaagatatttgcgaggag
caggtcaacagcctgccaggcagcatcactaaagcaggagacttccttgaagccaactac
atgaacctacagagatcctacactgtggccattgctggctatgctctggcccagatgggc
aggctgaaagggcctcttctcaacaaatttctgaccacagccaaagataagaaccgctgg
gaggaccctggtaagcagctctacaacgtggaggccacatcctatgccctcttggcccta
ctgcagctaaaagactttgactttgtgcctcccgtcgtgcgttggctcaatgaacagaga
tactacggtggtggctatggctctacccaggccaccttcatggtgttccaagccttggct
caataccaaaaggacgtccctgaccacaaggaactgaacctggatgtgtccctccaactg
cccagccgcagctccaagatcacccaccgtatccactgggaatctgccagcctcctgcga
tcagaagagaccaaggaaaatgagggtttcacagtcacagctgaaggaaaaggccaaggc
accttgtcggtggtgacaatgtaccatgctaaggccaaagatcaactcacctgtaataaa
ttcgacctcaaggtcaccataaaaccagcaccggaaacagaaaagaggcctcaggatgcc
aagaacactatgatccttgagatctgtaccaggtaccggggagaccaggatgccactatg
tctatattggacatatccatgatgactggctttgctccagacacagatgacctgaagcag
ctggccagtggtgttgacagatacatctccaagtatgagctggacaaagccttctccgat
aggaacaccctcatcatctacctggacaaggtctcacactctgaggatgactgtctagct
ttcaaagttcaccaatactttaatgtagagcttatccagcctggtgcagtcaaggtctac
gcctattacaacctggcggaaagctgtacccggttctaccatccggaaaaggaggatgga
aagctgaacaagctctgccgtgatgaactgtgccgctgtgctgaggagaattgcttcata
caaaagtcggatgacaaggtcaccctggaagaacggctggacaaggcctgtgagccagga
gtagactatgtgtacaagacccgactggtcaaggttcagctgtccaatgactttgacgag
tacatcatggccattgagcagaccatcaagtcaggctcggatgaggtgcaggttggacag
cagcgcacgttcatcagccccatcaagtgcagagaagccctgaagctggaggagaagaaa
cactacctcatgtggggtctctcctccgatttctggggagagaagcccaacctcagctac
atcatcgggaaggacacttgggtggagcactggcccgaggaggacgaatgccaagacgaa
gagaaccagcaacaatgccaggacctcggcgccttcaccgagagcatggttgtctttggg
tgccccaactga

DBGET integrated database retrieval system