KEGG   Pan paniscus (bonobo): 100984257
Entry
100984257         CDS       T02283                                 

Gene name
IL12RB2
Definition
(RefSeq) interleukin 12 receptor subunit beta 2
  KO
K05064  interleukin 12 receptor beta-2
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04060  Cytokine-cytokine receptor interaction
pps04630  JAK-STAT signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps05200  Pathways in cancer
pps05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100984257 (IL12RB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100984257 (IL12RB2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100984257 (IL12RB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100984257 (IL12RB2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100984257 (IL12RB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pps04050]
    100984257 (IL12RB2)
Cytokine receptors [BR:pps04050]
 Interleukin receptor families
  IL6/12 receptor family
   100984257 (IL12RB2)
SSDB
Motif
Pfam: fn3
Other DBs
NCBI-GeneID: 100984257
NCBI-ProteinID: XP_003807011
Position
1
AA seq 594 aa
MVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTPEEEPTGMLDVW
YMKMHIDYSRQQISLFWKNLSVSEARGKILHYQVTLQELTGGKAMTQNITGHTSWTTVIP
RTGNWAVAVSAANSKGSSLPTRINIMNLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDP
SAVQEYVVEWRELHPGGDTQVPLNWLRSPPYNVSALISENIKSYICYEIRVYALSGDQGG
CSSILGNSKHKAPLSGPHINAITEEKGSILISWNSIPVQEQMGCLLHYRIYWKERDSNSQ
PQLCEIPYRVSQNSHPINSLQPRVTYVLWMTALTAAGESSHGNEREFCLQGKANWMAFVA
PSICIAIIMVGIFSTHYFQQKVFVLLAALRPQWCSREIPDPANSTCAKKYPIAEEKTQLP
LDRLLIDWPTPEDPEPLVISEVLHQVTPVFRRPPCSNWPQREKGIQGHQASEKDMMHSAS
SPPPPRALQAESRQLVDLYKVLESRGSDPKPENPACPWTVLPAGDLPTHDGYLPSNIDDL
PSHEAPLADSLEELEPQHISLSVFPSSSLHPLTFSCGDKLTLDQLKMRCDSLML
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggttaatgttacaaaggccaaaggaagacatgatttgctggatctgaaaccatttaca
gaatatgaatttcagatttcctctaagctacatctttataagggaagttggagtgattgg
agtgaatcattgagagcacaaacaccagaagaagagcctactgggatgttagatgtctgg
tacatgaaaatgcacattgactacagtagacaacagatttctcttttctggaagaatctg
agtgtctcagaggcgagaggaaaaattctccactatcaggtgaccttgcaggagctgaca
ggagggaaagccatgacacagaacatcacaggacacacctcctggaccacagtcattcct
agaaccggaaattgggctgtggctgtgtctgcagcaaattcaaaaggcagttctctgccc
actcgtattaacataatgaacctgtgtgaggcagggttgctggctcctcgccaggtctct
gcaaactcagagggcatggacaacattctggtgacttggcagcctcccaggaaagatccc
tctgctgttcaggaatacgtggtggaatggagagagctccatccagggggtgacacacag
gtccctctaaactggctacggagtccaccctacaatgtgtctgctctgatttcagagaac
ataaaatcctacatctgttatgaaatccgtgtgtatgcactctcaggggatcaaggagga
tgcagctccatcctgggtaactctaagcacaaagcaccactgagtggcccccacattaat
gccatcacagaggaaaaggggagcattttaatttcatggaacagcattccagtccaggag
caaatgggctgcctcctccattacaggatatactggaaggaacgggactccaactcccag
cctcagctctgtgaaattccctatagagtctcccaaaattcacatccaataaacagcctg
cagccccgagtgacatatgtcctgtggatgacagctctgacagctgctggcgaaagttcc
cacggaaatgagagggaattttgtctgcaaggtaaagccaattggatggcgtttgtggca
ccaagcatttgcattgctatcatcatggtgggcattttctcaacgcattacttccagcaa
aaggtgtttgttctcctagcagccctcagacctcagtggtgtagcagagaaattccagat
ccagcaaatagcacttgtgctaagaaatatcccattgcagaggagaagacacagctgccc
ttggacaggctcctgatagactggcccacgcctgaagatcctgaaccgctggtcatcagt
gaagtccttcatcaagtgaccccagttttcagacgtcccccctgctccaactggccacaa
agggaaaaaggaatccaaggtcatcaggcctctgagaaagacatgatgcacagtgcctca
agcccaccacctccaagagctctccaagctgaaagcagacaactggtggatctgtacaag
gtgctggagagcaggggctcagacccaaagccagaaaacccagcctgtccctggacggtg
ctcccagcaggtgaccttcccacccacgatggctacttaccctccaacatagatgacctc
ccctcacatgaggcgcctctcgctgactctctggaagaactggagcctcagcacatctcc
ctttctgttttcccctcaagttctcttcacccactcaccttctcctgtggtgataagctg
actctggatcagttaaagatgaggtgtgactccctcatgctctga

DBGET integrated database retrieval system