KEGG   Pan paniscus (bonobo): 100984425
Entry
100984425         CDS       T02283                                 

Gene name
NLRP3
Definition
(RefSeq) NLR family pyrin domain containing 3
  KO
K12800  NACHT, LRR and PYD domains-containing protein 3
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04217  Necroptosis
pps04621  NOD-like receptor signaling pathway
pps04625  C-type lectin receptor signaling pathway
pps05132  Salmonella infection
pps05133  Pertussis
pps05135  Yersinia infection
pps05164  Influenza A
pps05171  Coronavirus disease - COVID-19
pps05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100984425 (NLRP3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100984425 (NLRP3)
   04625 C-type lectin receptor signaling pathway
    100984425 (NLRP3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100984425 (NLRP3)
   05164 Influenza A
    100984425 (NLRP3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100984425 (NLRP3)
   05135 Yersinia infection
    100984425 (NLRP3)
   05133 Pertussis
    100984425 (NLRP3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100984425 (NLRP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100984425 (NLRP3)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:pps04054]
    100984425 (NLRP3)
Membrane trafficking [BR:pps04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100984425 (NLRP3)
Pattern recognition receptors [BR:pps04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   100984425 (NLRP3)
SSDB
Motif
Pfam: NACHT NLRC4_HD2 PYRIN FISNA NOD2_WH LRR_6 LRR_4 NB-ARC
Other DBs
NCBI-GeneID: 100984425
NCBI-ProteinID: XP_003815386
UniProt: A0A2R8ZC66
Position
1
AA seq 979 aa
MKMASTRCKLARYLEDLEDVDLKKFKMHLEDYPPQKGCIPLPRGQTEKADHVDLATLMID
FNGEEKAWAMAVWIFAAINRRDLYEKAKRDEPKWGSDNACVSNPTVICQEDSIEEEWMGL
LEYLSRISICKMKKDYRKKYRKYVRSRFQCIEDRNARLGESVSLNKRYTRLRLIKEHRSQ
QEREQELLAIGKTKACESPVSPIKMEMLFDPDDEHSEPVHTVVFQGAAGIGKTILARKIM
LDWASGTLYQDRFDYLFYIHCREVSLVTQRSLGDLIMSCCPDPNPPIHKIVRKPSRILFL
MDGFDELQGAFDEHIGPLCTDWQKAERGDILLSSLIRKKLLPEASLLITTRPVALEKLQH
LLDHPRHVEILGFSEAKRKEYFFKYFSDEAQARAAFSLIQQNEVLFTMCFIPLVCWIVCT
GLKQQMESGKSLAQTSKTTTAVYVFFLSSLLQPRGGSQEHRLCAHLWGLCSLAADGIWNQ
KILFEESDLRNHGLQKADVSAFLRMNLFQKEVDCEKFYSFIHMTFQEFFAAMYYLLEEEK
EGRTNVPGSRLKLPSRDVTVLLENYGKFEKGYLIFVVRFLFGLVNQERTSYLEKKLSCKI
SQQIRLELLKWIEVKAKAKKLQIQPSQLELFYCLYEMQEEDFVQRAMDYFPKIEINLSTR
MDHVVSSFCIENCHRVESLSLGFLHNMPKEEEEEEKEGRHLDMVQCVLPGSSHAACSHGL
VNSHLTSSFCRGLFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRC
GLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVNSGLT
SVCCSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHC
CWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSA
LETLQEEKPELTVVFEPSW
NT seq 2940 nt   +upstreamnt  +downstreamnt
atgaagatggcaagcacccgctgcaagctggccaggtacctggaggacctggaggatgtg
gacttgaagaaatttaagatgcacttagaggactatcctccccagaagggctgcatcccc
ctcccgaggggtcagacagagaaggcagaccatgtggatctagccacgctaatgatcgac
ttcaatggggaggagaaggcgtgggccatggccgtgtggatcttcgctgcaatcaacagg
agagacctttatgagaaagcaaaaagagatgagccgaagtggggttcagataatgcatgt
gtttctaatcccactgtgatatgccaggaagacagcattgaagaggagtggatgggttta
ctggagtacctttcgagaatctctatttgtaaaatgaagaaagattaccgtaagaagtac
agaaagtacgtgagaagcagattccagtgcatcgaagacaggaatgcccgtctgggtgag
agtgtgagcctcaacaagcgctacacacgactgcgcctcatcaaggagcaccggagccag
caggagagggagcaggagcttctggccattggcaagaccaaggcgtgtgagagccccgtg
agtcccattaagatggagatgctgtttgaccccgatgatgagcattctgagcctgtgcac
accgtggtgttccagggagcggcagggattgggaaaacaatcctggccaggaagattatg
ttggactgggcgtcggggacactctaccaagacaggtttgactatctgttctatatccac
tgtcgggaggtgagccttgtgacacagaggagcctgggggacctgatcatgagctgctgc
cccgacccaaacccacccatccacaagatcgtgagaaaaccctccagaatcctcttcctc
atggacggcttcgacgagctgcaaggtgcctttgacgagcacataggaccgctctgcact
gactggcagaaggccgagcggggagacattctcctgagcagtctcatcagaaagaagctg
cttcccgaggcctctctgctcatcaccacgagacctgtggccctggagaaactgcagcac
ttgctggaccatcctcggcatgtggagatcctgggtttctctgaggccaaaaggaaagag
tacttcttcaagtacttctctgatgaggcccaagccagggcagccttcagtctgattcag
cagaacgaggtcctcttcaccatgtgcttcatccccctggtctgctggattgtgtgcact
ggactgaaacagcagatggagagtggcaagagccttgcccagacatccaagaccaccacc
gcggtgtacgtcttcttcctttccagtttgctgcagccccggggagggagccaggagcac
cgcctctgcgcccacctctgggggctctgctctttggctgcagatggaatctggaaccag
aaaatcctgtttgaggagtccgacctcaggaatcatgggctgcagaaggcggatgtgtct
gctttcctgaggatgaacctgttccaaaaggaagtggactgcgagaagttctacagcttc
atccacatgactttccaggagttctttgccgccatgtactacctgctggaagaggaaaag
gaaggaaggacgaacgttccagggagtcgtttgaagcttcccagccgagatgtgacagtc
cttctggaaaactatggcaaattcgaaaaggggtatttgatttttgttgtacgtttcctc
tttggcctggtgaaccaggagaggacctcctacttggagaagaaattaagttgcaagatc
tctcagcaaatcaggctggagctgctgaaatggattgaagtgaaagccaaagccaagaag
ctgcagatccagcccagccagctggaattgttctactgtttgtacgagatgcaggaggag
gacttcgtgcaaagggccatggactacttccccaagatcgagatcaatctctccaccaga
atggaccacgtggtttcttccttttgcattgagaactgtcatcgggtggagtcactgtcc
ctggggtttctccataacatgcccaaggaggaagaggaggaggaaaaggaaggccgacac
cttgatatggtgcagtgtgtcctcccaggctcctctcatgctgcctgttctcatggattg
gtgaacagccacctcacttccagtttttgccggggcctcttttcagttctgagcaccagc
cagagtctaactgaattggacctcagtgacaattctctgggggacccagggatgagagtg
ttgtgtgaaacgctccagcatcctggctgtaacattcggagattgtggttggggcgctgc
ggcctctcgcatgagtgctgcttcgacatctccttggtcctcagcagcaaccagaagctg
gtggagctggacctgagcgacaacgccctcggtgacttcgggatcagacttctgtgtgtg
ggactgaagcacctgttgtgcaatctgaagaagctctggttggtgaattctggccttacg
tcagtctgttgttcagctttgtcctcggtactcagcactaatcagaatctcacgcacctt
tacctgcgaggcaatactctcggagacaaggggatcaaactactctgtgagggactcttg
caccccgactgcaagcttcaggtgttggaattagacaactgcaacctcacgtcacactgc
tgctgggatctttccacacttctgacctccagccagagcctgcgaaagctgagcctgggc
aacaatgacctgggcgacctgggggtcatgatgttctgtgaagtgctcaaacagcagagc
tgcctcctgcagaacctggggttgtctgaaatgtatttcaattatgagacaaaaagtgcg
ttagaaacacttcaagaagaaaagcctgagctgaccgtcgtctttgagccttcttggtag

DBGET integrated database retrieval system