KEGG   Pan paniscus (bonobo): 100984607
Entry
100984607         CDS       T02283                                 

Gene name
CBLB
Definition
(RefSeq) Cbl proto-oncogene B
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04012  ErbB signaling pathway
pps04120  Ubiquitin mediated proteolysis
pps04144  Endocytosis
pps04625  C-type lectin receptor signaling pathway
pps04660  T cell receptor signaling pathway
pps04910  Insulin signaling pathway
pps05162  Measles
Brite
KEGG Orthology (KO) [BR:pps00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100984607 (CBLB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100984607 (CBLB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100984607 (CBLB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100984607 (CBLB)
   04660 T cell receptor signaling pathway
    100984607 (CBLB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100984607 (CBLB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100984607 (CBLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100984607 (CBLB)
   04121 Ubiquitin system [BR:pps04121]
    100984607 (CBLB)
Enzymes [BR:pps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100984607 (CBLB)
Membrane trafficking [BR:pps04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100984607 (CBLB)
Ubiquitin system [BR:pps04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    100984607 (CBLB)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-C3HC4_2 zf-RING_5 zf-C3HC4_4 zf-rbx1 UBA zf-RING_4
Other DBs
NCBI-GeneID: 100984607
NCBI-ProteinID: XP_003825099
UniProt: A0A2R9AMN4
Position
3
AA seq 982 aa
MANSMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHQVESVPSRDPPMPLEAWCPRDVFG
TNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLSIYLKGDVFDSASDPVPLPP
ARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQ
APARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNV
EVARSILREFAFPPPVSPRLNL
NT seq 2949 nt   +upstreamnt  +downstreamnt
atggcaaactcaatgaatggcagaaaccctggtggtcgaggaggaaatccccgaaaaggt
cgaattttgggtattattgatgctattcaggatgcagttggaccccctaagcaagctgcc
gcagatcgcaggaccgtggagaagacttggaagctcatggacaaagtggtaagactgtgc
caaaatcccaaacttcagttgaaaaatagcccaccatatatacttgatattttgcctgat
acatatcagcatttacgacttatattgagtaaatatgatgacaaccagaaacttgcccaa
ctcagtgagaatgagtactttaaaatctacattgatagccttatgaaaaagtcaaaacgg
gcaataagactctttaaagaaggcaaggagagaatgtatgaagaacagtcacaggacaga
cgaaatctcacaaaactgtcccttatcttcagtcacatgctggcagaaatcaaagcaatc
tttcccaatggtcaattccagggagataactttcgtatcacaaaagcagatgctgctgaa
ttctggagaaagttttttggagacaaaactatcgtaccatggaaagtattcagacagtgc
cttcatgaggtccaccaaattagctctggcctggaagcaatggctctaaaatcaacaatt
gatttaacttgcaatgattacatttcagtttttgaatttgatatttttaccaggctgttt
cagccttggggctctattttgcggaattggaatttcttagctgtgacacatccaggttac
atggcatttctcacgtatgatgaagttaaagcacgactacagaaatatagcaccaaaccc
ggaagctatattttccggttaagttgcactcgattgggacagtgggccattggctatgtg
actggggatgggaatatcttacagaccatacctcataacaagcccttatttcaagccctg
attgatggcagcagggaaggattttatctttatcctgatgggaggagttataatcctgat
ttaactggattatgtgaacctacacctcatgaccatataaaagttacacaggaacaatat
gaattatattgtgaaatgggctccacttttcagctctgtaagatttgtgcagagaatgac
aaagatgtcaagattgagccttgtgggcatttgatgtgcacctcttgccttacggcatgg
caggagtcggatggtcagggctgccctttctgtcgttgtgaaataaaaggaactgagccc
ataatcgtggacccctttgatccaagagatgaaggctccaggtgttgcagcatcattgac
ccctttggcatgccgatgctcgacttggacgacgatgatgatcgagaggagtccttgatg
atgaatcggttggcaaacgtccgaaagtgcactgacaggcagaactcaccagtcacatca
ccaggatcctctccccttgcccagagaagaaagccacagcctgacccactccagatccca
catctaagcctgccaccagtgcctcctcgcctggatctaattcagaaaggcatagttaga
tctccctgtggcagcccaacgggttcaccaaagtcttctccttgcatggtgagaaaacaa
gataaaccactcccagcaccacctcctcccttaagagatcctcctccaccgccacctgaa
agacctccaccaatcccaccagacaatagactgagtagacacatccatcaagtggaaagc
gtgccttccagagacccgccaatgcctcttgaagcatggtgccctcgggatgtgtttggg
actaatcagcttgtgggatgtcgactcctaggggagggctctccaaaacctggaatcaca
gctagttcaaatgtcaatggaaggcacagtagagtgggctctgacccagtgcttatgcgg
aaacacagacgccatgatttgcctttagaaggagctaaggtcttttccaatggtcacctt
ggaagtgaagaatatgatgttcctccccggctttctcctcctcctccagttaccaccctc
ctccctagcataaagtgtactggtccgttagcaaattctctttcagagaaaacaagagac
ccagtagaggaagatgatgatgaatacaagattccttcatcccaccctgtttccctgaat
tcacaaccatctcattgtcataatgtaaaacctcctgttcggtcttgtgataatggtcac
tgtatgctgaatggaacacatggtccatcttcagagaagaaatcaaacatccctgactta
agcatatatttaaagggagatgtttttgattcagcctctgatccagtgccattaccacct
gccaggcctccaactcgggacaatccaaagcatggttcttcactcaacaggacgccctct
gattatgatcttctcatccctccattaggtgaagatgcttttgatgcccttcctccatct
ctcccacctcccccacctcctgcaaggcatagtctcattgaacattcaaaacctcctggc
tccagtagccggccatcctcaggacaggatctttttcttcttccttcagatccctttgtt
gatctagcaagtggccaagttcctttgcctcccgctagaaggttaccaggtgaaaatgtc
aaaactaacagaacatcacaggactatgatcagcttccttcatgttcagatggttcacag
gcaccagccagaccccctaaaccacgaccccgcaggactgcaccagaaattcaccacaga
aaaccccatgggcctgaggcggcattggaaaatgtcgatgcaaaaattgcaaaactcatg
ggagagggttatgcctttgaagaggtgaagagagccttagagatagcccagaataatgtc
gaagttgcccggagcatcctccgagaatttgccttccctcctccagtatccccacgtcta
aatctatag

DBGET integrated database retrieval system