KEGG   Pan paniscus (bonobo): 100985203
Entry
100985203         CDS       T02283                                 

Gene name
SP1
Definition
(RefSeq) Sp1 transcription factor
  KO
K04684  transcription factor Sp1
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01522  Endocrine resistance
pps04137  Mitophagy - animal
pps04350  TGF-beta signaling pathway
pps04915  Estrogen signaling pathway
pps04927  Cortisol synthesis and secretion
pps04928  Parathyroid hormone synthesis, secretion and action
pps04934  Cushing syndrome
pps05016  Huntington disease
pps05017  Spinocerebellar ataxia
pps05163  Human cytomegalovirus infection
pps05200  Pathways in cancer
pps05202  Transcriptional misregulation in cancer
pps05224  Breast cancer
pps05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100985203 (SP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100985203 (SP1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100985203 (SP1)
   04928 Parathyroid hormone synthesis, secretion and action
    100985203 (SP1)
   04927 Cortisol synthesis and secretion
    100985203 (SP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100985203 (SP1)
   05202 Transcriptional misregulation in cancer
    100985203 (SP1)
   05231 Choline metabolism in cancer
    100985203 (SP1)
  09162 Cancer: specific types
   05224 Breast cancer
    100985203 (SP1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100985203 (SP1)
   05017 Spinocerebellar ataxia
    100985203 (SP1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100985203 (SP1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100985203 (SP1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100985203 (SP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pps03000]
    100985203 (SP1)
   03029 Mitochondrial biogenesis [BR:pps03029]
    100985203 (SP1)
Transcription factors [BR:pps03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100985203 (SP1)
Mitochondrial biogenesis [BR:pps03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100985203 (SP1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 100985203
NCBI-ProteinID: XP_003831062
UniProt: A0A2R9AJI5
Position
12
AA seq 786 aa
MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGSSSSTGGGGGQESQPS
PLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPT
SKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTGLPGVMPNIQYQVIPQF
QTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQ
GLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPV
TSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRV
SGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAP
LSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQA
QTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGT
SGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRT
RREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCT
WSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVAL
SVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSIN
ISGNGF
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaaatgacagctgtggtgaaaattgaaaaagga
gttggtggcaataatgggggcaatggtaatggtggtggtgccttttcacaggctcgaagt
agcagcacaggcagtagcagcagcactggaggaggaggagggcaggagtcccagccgtcc
cctttggctctgctggcagcaacttgcagcagaattgagtcacccaatgagaacagcaac
aactcccagggcccgagtcagtcagggggaacaggtgagcttgacctcacagccacacaa
ctttcacagggtgccaatggctggcagatcatctcttcctcctctggggctacccctacc
tcaaaggaacagagtggcagcagtaccaatggcagcaatggcagtgagtcttccaagaat
cgcacagtctctggtgggcagtatgttgtggctgccgctcccaacttacagaaccagcaa
gttctgacaggactacctggagtgatgcctaatattcagtatcaagtaatcccacagttc
cagaccgttgatgggcaacagctgcagtttgctgctactggggcccaagtgcagcaggat
ggttctggtcaaatacagatcataccaggtgcaaaccaacagattatcacaaatcgagga
agtggaggcaacatcattgctgctatgccaaacctactccagcaggctgtccccctccaa
ggtctggctaataatgtactctcaggacagactcagtatgtgaccaatgtaccagtggcc
ctgaatgggaacatcaccttgctacctgtcaacagcgtttctgcagctaccttgactccc
agctctcaggcagtcacgatcagcagctctgggtcccaggagagtggctcacagcctgtc
acctcagggactaccatcagttctgccagcttggtatcatcacaagccagttccagctcc
tttttcaccaatgccaatagctactcaactactactaccaccagcaacatgggaattatg
aactttactaccagtggatcatcagggaccaactctcaaggccagacaccccagagggtc
agtgggctacaggggtctgatgctctgaacatccagcaaaaccagacatctggaggctca
ttgcaagcaggccagcaaaaagaaggagagcaaaaccagcagacacagcagcaacaaatt
cttatccagcctcagctagttcaagggggacaggccctccaggccctccaagcagcacca
ttgtcagggcagacctttacaactcaagccatctcccaggaaaccctccagaacctccag
cttcaggctgttccaaactctggtcccatcatcatccggacaccaacagtggggcctaat
ggacaggtcagttggcagactctacagctgcagaacctccaagttcagaacccacaagcc
cagacaatcaccttagccccaatgcagggtgtttccttggggcagaccagcagcagcaac
accactctcacacccattgcctcagctgcttccattcctgctggcacagtcactgtgaat
gctgctcaactctcctccatgccaggcctccagaccattaacctcagtgcattgggtact
tcaggaatccaggtgcacccaattcaaggcctgccgttggctatagcaaatgccccaggt
gatcatggagctcagcttggtctccatggggctggtggtgatggaatacatgatgacaca
gcaggtggagaggaaggagaaaacagcccagatgcccaaccccaagccggtcggaggacc
cggcgggaagcatgcacctgcccctactgtaaagacagtgaaggaaggggctcgggggat
cctggcaaaaagaaacagcatatttgccacatccaaggctgtgggaaagtgtatggcaag
acctcacacctgcgggcacacttgcgctggcatacaggcgagaggccatttatgtgtacc
tggtcatactgtgggaaacgcttcacacgttcggatgagctacagaggcacaaacgtaca
cacacaggtgagaagaaatttgcctgccctgagtgtcctaagcgcttcatgaggagtgac
cacctgtcaaaacatatcaagacccaccagaataagaagggaggcccaggtgtagctctg
agtgtgggcactttgcccctggacagtggggcaggttcagaaggcagtggcactgccact
ccttcagcccttattaccaccaatatggtagccatggaggccatctgtccagagggcatt
gcccgtcttgccaacagtggcatcaacgtcatgcaggtggcagatctgcagtccattaat
atcagtggcaatggcttctga

DBGET integrated database retrieval system