KEGG   Pan paniscus (bonobo): 100986388
Entry
100986388         CDS       T02283                                 

Gene name
AKR1C3
Definition
(RefSeq) aldo-keto reductase family 1 member C3
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00140  Steroid hormone biosynthesis
pps00590  Arachidonic acid metabolism
pps00790  Folate biosynthesis
pps01100  Metabolic pathways
pps04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100986388 (AKR1C3)
   00590 Arachidonic acid metabolism
    100986388 (AKR1C3)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100986388 (AKR1C3)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100986388 (AKR1C3)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     100986388 (AKR1C3)
    1.1.1.188  prostaglandin-F synthase
     100986388 (AKR1C3)
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     100986388 (AKR1C3)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     100986388 (AKR1C3)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 100986388
NCBI-ProteinID: XP_008951352
UniProt: A0A2R9A618
Position
10
AA seq 300 aa
MQISQVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTS
KLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVD
LCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLL
DFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQR
GVVVLAKSYNEQRIRENVQVFEFQLTAEDMKAIDGLDRNLRYFNSDSLASHPNYPYSDEY
NT seq 903 nt   +upstreamnt  +downstreamnt
atgcaaatatcacaggttccgagaagtaaagctttggaggtcacaaaattagcaatagaa
gctgggttccgccatatagattctgctcatttatacaataatgaggagcaggttggactg
gccatccgaagcaagattgcagatggcagtgtgaaaagagaagacatattctacacttca
aagctttggtccacttttcatcgaccagagttggtccgaccagccttggaaaactcgctg
aaaaaagctcaattggactatgttgacctctatcttattcattctccaatgtctctaaag
ccaggtgaggaactttcaccaacagatgaaaatggaaaagtaatatttgacatagtggat
ctctgtaccacctgggaggccatggagaagtgtaaggatgcaggattggccaagtccatt
ggggtgtcaaacttcaaccgcaggcagctggagatgatcctcaacaagccaggactcaag
tacaagcctgtctgcaaccaggtagaatgtcatccgtatttcaaccggagtaaattgcta
gatttctgcaagtcaaaagatattgttctggttgcctatagtgctctgggatctcaacga
gacaaacgatgggtggacccgaactccccggttctcttggaggacccagtcctttgtgcc
ttggcaaaaaagcacaagcgaaccccagccctgattgccctgcgctaccagctgcagcgt
ggggttgtggtcctggccaagagctacaatgagcagcgcatcagagagaatgtccaggtt
tttgagttccagttgactgcagaggacatgaaagccatagatggcctagacagaaatctc
cgctattttaacagtgatagtcttgctagccaccctaattatccatattcagatgaatat
taa

DBGET integrated database retrieval system