KEGG   Pan paniscus (bonobo): 100986423
Entry
100986423         CDS       T02283                                 

Gene name
SRC
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01521  EGFR tyrosine kinase inhibitor resistance
pps01522  Endocrine resistance
pps04012  ErbB signaling pathway
pps04015  Rap1 signaling pathway
pps04062  Chemokine signaling pathway
pps04137  Mitophagy - animal
pps04144  Endocytosis
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04510  Focal adhesion
pps04520  Adherens junction
pps04530  Tight junction
pps04540  Gap junction
pps04611  Platelet activation
pps04613  Neutrophil extracellular trap formation
pps04625  C-type lectin receptor signaling pathway
pps04727  GABAergic synapse
pps04750  Inflammatory mediator regulation of TRP channels
pps04810  Regulation of actin cytoskeleton
pps04912  GnRH signaling pathway
pps04915  Estrogen signaling pathway
pps04917  Prolactin signaling pathway
pps04919  Thyroid hormone signaling pathway
pps04921  Oxytocin signaling pathway
pps04926  Relaxin signaling pathway
pps05100  Bacterial invasion of epithelial cells
pps05135  Yersinia infection
pps05152  Tuberculosis
pps05161  Hepatitis B
pps05163  Human cytomegalovirus infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05203  Viral carcinogenesis
pps05205  Proteoglycans in cancer
pps05219  Bladder cancer
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100986423 (SRC)
   04015 Rap1 signaling pathway
    100986423 (SRC)
   04370 VEGF signaling pathway
    100986423 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100986423 (SRC)
   04137 Mitophagy - animal
    100986423 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100986423 (SRC)
   04520 Adherens junction
    100986423 (SRC)
   04530 Tight junction
    100986423 (SRC)
   04540 Gap junction
    100986423 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100986423 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100986423 (SRC)
   04613 Neutrophil extracellular trap formation
    100986423 (SRC)
   04625 C-type lectin receptor signaling pathway
    100986423 (SRC)
   04062 Chemokine signaling pathway
    100986423 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100986423 (SRC)
   04915 Estrogen signaling pathway
    100986423 (SRC)
   04917 Prolactin signaling pathway
    100986423 (SRC)
   04921 Oxytocin signaling pathway
    100986423 (SRC)
   04926 Relaxin signaling pathway
    100986423 (SRC)
   04919 Thyroid hormone signaling pathway
    100986423 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    100986423 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100986423 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    100986423 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100986423 (SRC)
   05203 Viral carcinogenesis
    100986423 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    100986423 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100986423 (SRC)
   05168 Herpes simplex virus 1 infection
    100986423 (SRC)
   05163 Human cytomegalovirus infection
    100986423 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100986423 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100986423 (SRC)
   05152 Tuberculosis
    100986423 (SRC)
   05100 Bacterial invasion of epithelial cells
    100986423 (SRC)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100986423 (SRC)
   05418 Fluid shear stress and atherosclerosis
    100986423 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100986423 (SRC)
   01522 Endocrine resistance
    100986423 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100986423 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100986423 (SRC)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100986423 (SRC)
Protein kinases [BR:pps01001]
 Non-receptor tyrosine kinases
  SRC family
   100986423 (SRC)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100986423 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    100986423 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100986423 (SRC)
  Macropinocytosis
   Kinases
    100986423 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_9 SH3_1 SH3_2 ABC1 Haspin_kinase
Other DBs
NCBI-GeneID: 100986423
NCBI-ProteinID: XP_008955538
Position
20
AA seq 477 aa
MTMSLGRRQTCPSRKASGSRLSTTPLSQLLPLSASLSLALRRKVDVSQTWFTFRWLQREG
DWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRE
SETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADG
LCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKT
LKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGK
YLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVE
RGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgactatgagtctaggacggagacagacctgtccttcaagaaaggcgagcggctccaga
ttgtcaacaacacccctctctcagcttctccctctctctgcttctctctcgctggccctt
aggaggaaggtggatgtcagccagacctggttcacattcagatggctgcaaagagaggga
gactggtggctggcccactcgctcagcacaggacagacaggctacatccccagcaactac
gtggcgccctccgactccatccaggccgaggagtggtattttggcaagatcaccagacgg
gagtcagagcggttactgctcaatgcagagaacccgagagggaccttcctcgtgcgagaa
agtgagaccacgaaaggtgcctactgcctctcagtgtctgacttcgacaacgccaagggc
ctcaatgtgaagcactacaagatccgcaagctggacagcggtggcttctacatcacctcc
cgcacccagttcaacagcctgcagcagctggtggcctactactccaaacacgccgatggc
ctgtgccaccgcctcaccaccgtgtgccccacgtccaagccgcagactcagggcctggcc
aaggatgcctgggagatccctcgggagtcgctgcggctggaggtcaagctgggccagggc
tgctttggcgaggtgtggatggggacctggaacggtaccaccagggtggccatcaaaacc
ctgaagcctggcacgatgtctccagaggccttcctgcaggaggcccaggtcatgaagaag
ctgaggcatgagaagctggtgcagttgtatgctgtggtttcagaggagcccatttacatc
gtcacggagtacatgagcaaggggagtttgctggactttctcaagggggagacaggcaag
tacctgcggctgcctcagctggtggacatggctgctcagatcgcctcaggcatggcgtac
gtggagcggatgaactacgtccaccgggaccttcgtgcagccaacatcctggtgggagag
aacctggtgtgcaaagtggccgactttgggctggctcggctcattgaagacaatgagtac
acggcgcggcaaggtgccaaattccccatcaagtggacggctccagaagctgccctctat
ggccgcttcaccatcaagtcagacgtgtggtccttcgggatcctgctgactgagctcacc
acaaagggacgggtgccctaccctgggatggtgaaccgcgaggtgctggaccaggtggag
cggggctaccggatgccctgcccgccggagtgtcccgagtccctgcacgacctcatgtgc
cagtgctggcggaaggagcctgaggagcggcccaccttcgagtacctgcaggccttcctg
gaggactacttcacgtccaccgagccccagtaccagcccggggagaacctctag

DBGET integrated database retrieval system