KEGG   Pan paniscus (bonobo): 100988315
Entry
100988315         CDS       T02283                                 

Definition
(RefSeq) estradiol 17 beta-dehydrogenase 5-like
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00140  Steroid hormone biosynthesis
pps00590  Arachidonic acid metabolism
pps00790  Folate biosynthesis
pps01100  Metabolic pathways
pps04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100988315
   00590 Arachidonic acid metabolism
    100988315
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100988315
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    100988315
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     100988315
    1.1.1.188  prostaglandin-F synthase
     100988315
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     100988315
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     100988315
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 100988315
NCBI-ProteinID: XP_003827827
UniProt: A0A2R8ZWF1
Position
10
AA seq 303 aa
MDLKQSHSLRLNDGHVMPMLGFGTYAPDHTPKSKAGEATEVAIDAGFRHIDAAFHQNEEK
VGKAIREKIADGTVKREDIFYTTKLWTTFFRPELVHPALERSLKKLQLDYVDLFIIHNPL
AMKPGEELLPKDASGNIIFDTVDLRDTWEALEKCKDAGLTKSIGVSNFSHKLLELILNKP
GLKYKPTCNQVECHPYLNQSKLLEFCKSKDIVLVAYSALASHRDPNWVDPDSPYLLEEPT
LKSIAKKYNRSPGQVALCYQLQRGVVVLAKSFSEKRIKENFQVFDFELTPEDMKVTDGLN
RNF
NT seq 912 nt   +upstreamnt  +downstreamnt
atggatctgaagcaaagccattccttgaggctgaatgatggacatgtcatgccgatgctg
ggatttggcacttatgctcctgatcatacccccaagagcaaggctggtgaagccaccgaa
gtggctattgatgcaggcttccgtcacattgatgcggcgttccaccaaaatgaggagaag
gtcggaaaggccattcgagagaagattgctgacggcactgtgaagagagaggacattttc
tacaccactaagctttggacaactttctttagaccagaattagttcacccagccctggaa
aggtcactgaagaaacttcaactggactatgtcgatctcttcattatccacaatccattg
gctatgaagcctggggaggaattgctgcctaaggatgccagtggaaacattatttttgat
actgtggatcttcgtgacacatgggaggccctggagaagtgcaaagatgcaggtttaacc
aagtccatcggggtgtccaatttcagtcacaaactgctggaactcatcctcaacaagcca
gggctcaagtacaagcccacctgcaaccaggtggaatgtcacccttacctcaaccagagc
aaactcctggagttctgcaagtccaaggacattgttctagttgcctacagtgccctggca
tctcacagagacccaaactgggtggacccagatagcccatatctcttagaggagccaacc
ttgaaatccattgccaagaaatacaatagaagcccaggccaggttgccctgtgctaccag
ctgcagcggggggtggtggtcctggccaagagcttctctgagaagagaatcaaagagaac
ttccaggtttttgactttgagctgactccagaggacatgaaagtcactgatggcctcaac
agaaatttctga

DBGET integrated database retrieval system