KEGG   Pan paniscus (bonobo): 100990455Help
Entry
100990455         CDS       T02283                                 

Gene name
SNX17
Definition
(RefSeq) sorting nexin 17
  KO
K17929  sorting nexin-17
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    100990455 (SNX17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNX17_FERM_C PX RA FERM_M Nod1 Ras_bdg_2 DUF2777
Motif
Other DBs
NCBI-GeneID: 100990455
NCBI-ProteinID: XP_003827141
UniProt: A0A2R9CN12
Position
2A
AA seq 470 aa AA seqDB search
MHFSIPETESRSGDSGGSAYVAYNIHVNGVLHCRVRYSQLLGLHEQLRKEYGANVLPAFP
PKKLFSLTPAEVEQRREQLEKYMQAVRQDPLLGSSETFNSFLRRAQQETQQVPTEEVSLE
VLLSNGQKVLVNVLTSDQTEDVLEAVAAKLDLPDDLIGYFSLFLVREKEDGAFSFVRKLQ
EFELPYVSVTSLRSKEYKIVLRKSYWDSAYDDDVMENRVGLNLLYAQTVSDIERGWILVT
KEQHRQLKSLQEKVSKKEFLRLAQTLRHYGYLRFDACVADFPEKDCPVVVSAGNSELSLQ
LRLPGQQLREGSFRVTRMRCWRVTSSVPLPSGSTSSPGRGRGEVRLELAFEYLMSKDRLQ
WVTITSPQAIMMSICLQSMVDELMVKKSGGSIRKMLRRRVGGTLRRSDSQQAVKSPPLLE
SPDATRESMVKLSSKLSAVSLRGIGSPSTDASASDVHGNFAFEGIGDEDL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcacttttccattcccgaaaccgagtcccgcagcggggacagcggcggctccgcctac
gtggcctataacattcacgtgaatggagtcctgcactgtcgggtgcgctacagccagctc
ctggggctgcacgagcagcttcggaaggagtatggggccaatgtgcttcctgcattcccc
ccaaagaagcttttctctctgactcctgctgaggtagaacagaggagagagcagttagag
aagtacatgcaagctgttcggcaagacccattgcttgggagcagcgagaccttcaacagt
ttcctgcgtcgggcacaacaggagacacagcaggtccccacagaggaagtgtccttggaa
gtgctgctcagcaacgggcagaaagttctggtcaacgtgctaacttcagatcagactgag
gatgtcctggaggctgtagctgcaaagctggatcttccagatgacttgattggatacttc
agtctattcttagttcgagaaaaagaggatggagccttttcttttgtacggaagttgcag
gagtttgagctgccttatgtgtctgtcaccagccttcggagtaaagagtataagattgtg
ctaaggaagagttattgggactctgcctatgatgacgatgtcatggagaaccgggttggc
ctgaacctgctttatgctcagacggtatcagatattgagcgtgggtggatcttggtcacc
aaggaacagcaccggcaactcaaatctctgcaagagaaagtctccaagaaggagttcctg
agactggcccagacgctgcggcactatggctacctgcgctttgatgcctgtgtggctgac
ttcccagaaaaggactgtcctgtggtggtgagcgcgggcaacagtgagctcagcctgcag
ctccgcctgcctggccagcaactccgagaaggctccttccgggtcacccgcatgcgatgc
tggcgggtcacctcctctgtaccattgcccagtggaagcacgagcagcccaggccggggc
cggggtgaggtgcgcctggaactggcttttgaatacctcatgagcaaggaccggctacag
tgggtcaccatcactagcccccaggctatcatgatgagcatctgcttgcagtccatggtt
gatgaactgatggtgaagaaatctggcggcagtatcaggaagatgctgcgccggcgggtg
gggggcactctgagacgctcagacagccagcaagcagtgaagtccccaccactgcttgag
tcacctgatgccacccgggagtctatggtcaaactctcaagtaagctgagtgccgtgagc
ttgcggggaattggcagtcccagcacagatgccagtgccagtgatgtccacggcaatttc
gccttcgagggcattggagatgaggatctgtaa

DBGET integrated database retrieval system