KEGG   Pan paniscus (bonobo): 100990670
Entry
100990670         CDS       T02283                                 

Gene name
ANKMY2
Definition
(RefSeq) ankyrin repeat and MYND domain containing 2
Organism
pps  Pan paniscus (bonobo)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3 zf-MYND PolC_DP2
Other DBs
NCBI-GeneID: 100990670
NCBI-ProteinID: XP_003825059
UniProt: A0A2R9CK16
Position
7
AA seq 441 aa
MVHIQKGELTQEEKELLEVIGKGTVQEAGTLLSSKNVRVNCLDENGMTPLMHAAYKGKLD
MCKLLLRHGADVNCHQHEHGYTALMFAALSGNKDITWVMLEAGAETDVVNSVGRTAAQMA
AFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKLPPKLAGPLHKIITTTNLHPVKIVM
LVNENPLLTEEAALNKCYRVMDLICEKCMKQRDMNEVLAMKMHYISCIFQKCINFLKDGE
NKLDTLIKSLLKGRASDGFPVYQEKIIRESIRKFPYCEATLLQQLVRSIAPVEIGSDPTA
FSVLTQAITGQVGFVDVEFCTTCGEKGASKRCSVCKMVIYCDQTCQKTHWFTHKKICKNL
KDIYEKQQLEAAKEKRQEENHGKLDVNSNCVNEEQPEAEVGISQKDSNPEDSGEGKKESL
ESEAELEGFQDAPAGPQVSEE
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggttcacatacagaaaggcgagctgacccaggaggagaaggagctactggaagtcatc
gggaaaggtactgtccaagaagctggaacattattatccagcaagaatgttcgtgtcaac
tgtttggacgagaatggaatgactcctctaatgcatgcagcatataaaggaaaactcgat
atgtgcaaattactactgcgacatggagccgatgtaaattgtcatcagcatgaacatgga
tacacagccctcatgtttgctgcactttctggtaataaagacatcacgtgggtaatgtta
gaagctggtgctgagacagatgttgtcaactctgtgggaagaacagcagctcagatggca
gcctttgtgggtcaacatgattgtgtgaccataatcaacaatttctttcctcgagagaga
ctggattattacactaagccacagggactggataaagagccaaaactgcccccaaagttg
gcaggcccgctgcacaaaattatcaccacaacgaatcttcatcctgtcaagatcgtgatg
cttgtaaatgagaatcctctgctgacagaagaagcagccctgaataaatgctacagagtg
atggatttgatttgtgagaaatgtatgaagcaaagagacatgaatgaagtattggctatg
aagatgcattacataagctgtatctttcagaaatgcattaacttcttaaaagatggagag
aataaactggacaccttgatcaaaagcttgttaaaaggccgagcttctgatggctttcca
gtgtatcaagaaaagatcattagagaaagtatcagaaaatttccttactgtgaagctaca
ctcctccagcagctggttcgaagcattgctcctgttgaaattggttctgatcccactgca
ttctccgtccttacccaagccatcactggccaggtgggttttgtggatgtggaattttgc
actacctgtggagaaaagggagcaagtaaaagatgttcagtttgcaaaatggtaatatat
tgtgatcaaacctgccagaaaacacactggtttactcataagaaaatctgtaagaatctg
aaggacatttacgaaaagcaacagttggaggctgccaaagaaaagagacaagaggaaaac
cacggcaaacttgatgtcaattctaactgtgttaatgaagagcaaccagaggctgaagta
ggtatctctcaaaaggattcaaatcctgaagattccggggaaggaaagaaagaatctctt
gaaagcgaagctgagttggaaggcttccaggatgctcctgcagggccacaggtgtctgag
gagtaa

DBGET integrated database retrieval system