KEGG   Pan paniscus (bonobo): 100992138
Entry
100992138         CDS       T02283                                 

Gene name
KIF16B
Definition
(RefSeq) kinesin family member 16B
  KO
K17916  kinesin family member 16B
Organism
pps  Pan paniscus (bonobo)
Brite
KEGG Orthology (KO) [BR:pps00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pps04812]
    100992138 (KIF16B)
Cytoskeleton proteins [BR:pps04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100992138 (KIF16B)
SSDB
Motif
Pfam: Kinesin Microtub_bd PX Kinesin_assoc FHA Yop-YscD_cpl
Other DBs
NCBI-GeneID: 100992138
NCBI-ProteinID: XP_003810635
UniProt: A0A2R8ZGR0
Position
20
AA seq 1317 aa
MASVKVAVRVRPMNRREKDLEAKFIIQMEKSKTTITNLKIPEGGTGDSGRERTKTFTYDF
SFYSADTKSPDYVSQEMVFKTLGTDVVKSAFEGYNACVFAYGQTGSGKSYTMMGNSGDSG
LIPRICEGLFSRINETTRWDEASFRTEVSYLEIYNERVRDLLRRKSSKTFNLRVREHPKE
GPYVEDLSKHLVQNYGDVEELMDAGNINRTTAATGMNDVSSRSHAIFTIKFTQAKFDSEM
PCETVSKIHLVDLAGSERADATGATGVRLKEGGNINKSLVTLGNVISALADLSQDAANTL
AKKKQVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRYANRAKNIIN
KPTINEDANVKLIRELRAEIARLKTLLAQGNQIALLDSPTALSMEEKLQQNEARVQELTK
EWTNKWNETQNILKEQTLALRKEGIGVVLDSELPHLIGIDDDLLSTGIILYHLKEGQTYV
GRDDASTEQDIVLHGLDLESEHCIFENIGGTVTLIPLSGSQCSVNGVQIVEATHLNQGAV
ILLGRTNMFRFNHPKEAAKLREKRKSGLLSSFSLSMTDLSKSRENLSAVMLYNPGLEFER
QQREELEKLESKRKLIEEMEEKQKSDKAELERMQQEVETQRKETEIVQLQIRKQEESLKR
RSFHIENKLKDLLAEKEKFEEERLREQQEIELQKKRQEEETFLRAQEELQRLKELNNNEK
AEKFQIFQELDQLQKEKDEQYAKLELEKKRLEEQEKEQVMLVAHLEAQLREKQEMIQLLR
RGEVQWVEEEKRDLEGIRESLLRVKEARAGGDEDGEELEKAQLRFFEFKRRQLVKLVNLE
KDLVQQKDILKKEVQEEQEILEYLKCEHDKESRLLEKHDESVTDVTEVAQDFEKIKPVEY
RLQYKERQLQYLLQNHLPTLLEEKQRAFEILDRGPLSLDNTLYQVEKEMEEKEEQLAQYQ
ANANQLQKLQATFEFTANIARQEEKVRKKEKEILESREKQQREALERALARLERRHSALQ
RRSTLGMEIEEQRQKLASLNSGSREQSGLQASLEAEQEALEKDQERLKYEIQQLKQKIYE
VDGVQKGHHGTLEGKVASSSLPVSAEKSHLVPLMDARINAYIEEEVQRRLQDLHRVINEG
CSTSADTMKDNEKLHNGTIQRKLKYERMVSRSLGANPDDLKDPIKISIPRYVLCGQGKDA
HFEFEVKITVLDETWTVFRRYSRFREMHKTLKLKYAELAALEFPPKKLFGNKDERVIAER
RSHLEKYLRDFFSVMLQSTTSPLHINKVGLTLSKHTICEFSPFFKKGVFDYSSHGTG
NT seq 3954 nt   +upstreamnt  +downstreamnt
atggcatcggtcaaggtggccgtgagggtccggcccatgaatcgcagggaaaaggacttg
gaggccaagttcattattcagatggagaaaagcaaaacgacaatcacaaacttaaagata
ccagaaggaggcactggggactcaggaagagaacggaccaagaccttcacctatgacttt
tctttttattctgctgatacaaaaagcccagattacgtttcacaagaaatggttttcaaa
accctcggcacagatgtcgtgaagtctgcatttgaaggttataatgcttgtgtctttgca
tatgggcaaactggatctggaaagtcatacactatgatgggaaattctggagattctggc
ttaatacctcggatctgtgaagggctcttcagtcggataaatgaaaccaccagatgggat
gaagcttcttttcgaactgaagtcagctacttagaaatttataacgagcgtgtgagagat
ctacttcggcggaagtcatctaaaaccttcaatttgagagtccgtgagcatcccaaagaa
ggcccttatgttgaggatttatccaaacatttagtacagaattatggtgacgtagaagaa
cttatggatgcgggcaatatcaaccggaccaccgcagcgactgggatgaacgacgtcagt
agcaggtctcatgccatcttcaccatcaagttcactcaggctaaatttgattctgaaatg
ccatgtgaaaccgtcagtaagatccacttggttgatcttgccggaagtgagcgtgcagat
gccaccggagccaccggggttaggctaaaggaagggggaaatattaacaagtccctcgtg
actctggggaacgtcatttctgccttagctgatttatctcaggatgctgcaaatactctt
gcaaagaagaagcaagttttcgtgccttacagggattctgtgttgacttggttgttaaaa
gatagccttggaggaaactctaaaactatcatgattgccaccatttcacctgctgatgtc
aattatggagaaaccctaagtactcttcgctatgcaaatagagccaaaaacatcatcaac
aagcctaccattaatgaggatgccaacgtcaaacttatccgtgagctgcgagctgaaata
gccagactgaaaacgctgcttgctcaagggaatcagattgccctcttagactcccccaca
gctttaagtatggaggaaaaacttcagcagaatgaagcaagagttcaagaattgaccaag
gaatggacaaataagtggaatgaaacccaaaatattttgaaagaacaaactctagccctc
aggaaagaagggattggagttgttttggattctgaactgcctcatttgattggcatcgat
gatgaccttttgagtactggaatcatcttatatcatttaaaggaaggtcagacatatgtt
ggtagagacgatgcttccacggagcaagatattgttcttcatggccttgacttggagagt
gagcattgcatctttgaaaatatcggggggacagtgactctgatacccctgagtgggtcc
cagtgctctgtgaatggtgttcagatcgtggaggccacacatctaaatcaaggtgctgtg
attctcttgggaagaaccaatatgtttcgctttaaccatccaaaggaagccgccaagctc
agggagaagaggaagagtggccttctgtcctccttcagcttgtccatgaccgacctctcg
aagtcccgtgagaacctgtctgcagtcatgttgtataaccccggacttgaatttgagagg
caacagcgtgaagaacttgaaaaattagaaagtaaaaggaaactcatagaagaaatggag
gaaaagcagaaatcagacaaggctgaactggagcggatgcagcaggaggtggagacccag
cgcaaggagacagaaatcgtgcagctccagattcgcaagcaggaggagagcctcaaacgc
cgcagcttccacatcgagaacaagctaaaggatttacttgctgagaaggaaaaatttgaa
gaggagaggctgagggaacagcaggaaatcgagctgcagaagaagagacaagaagaagag
acctttctccgcgcccaagaagaactccaacgactcaaagaactcaacaacaatgagaag
gctgagaagtttcagatatttcaagaactggaccagctccaaaaggaaaaagatgaacag
tatgccaagcttgaactggaaaaaaagagactagaggagcaggagaaggagcaggtcatg
ctcgtggcccatctggaagcgcagctccgagagaagcaggagatgatccagctcctgcgg
cgcggggaggtgcagtgggtggaagaggagaagagggacctggaaggcattcgggaatcc
ctcctgcgggtgaaggaggctcgtgccggaggggatgaagatggcgaggagttagaaaag
gctcaactgcgtttcttcgaattcaagagaaggcagcttgtcaagctagtgaacttggag
aaggacctggttcagcagaaagacatcctgaaaaaagaagtccaagaagaacaggagatt
ctagagtatttaaaatgtgaacatgacaaagaatctagattgttggaaaaacatgatgag
agtgtcacagatgtcacggaagtggctcaagatttcgagaaaataaagccagtggagtac
aggctgcaatataaagaacgccagctacagtacctcctgcagaatcacttgccaactctg
ttggaagaaaagcagagagcatttgaaattcttgacagaggccctctcagcttagacaac
actctttatcaagtagaaaaggaaatggaagaaaaagaagaacagcttgcacagtaccag
gccaatgcaaaccagctgcaaaagctccaagccacctttgaattcactgccaacattgca
cgtcaggaggaaaaagtgaggaaaaaggaaaaggagattttggagtccagagagaagcag
cagagagaggcgctggagcgggccctggccaggctggagaggagacattctgcgctgcag
aggcgctccaccctgggcatggagattgaagagcagaggcagaaacttgccagtctgaac
agtggcagcagagagcagtcagggctccaggctagcctggaggctgagcaggaagcccta
gagaaggaccaggagaggttaaaatatgaaatccagcagctgaaacagaagatttatgag
gtcgatggtgttcagaaaggtcatcatgggaccctggaagggaaggtggcttcttccagc
ttgccagtcagtgctgaaaaatcacacctggttcccctcatggatgccaggatcaatgct
tacattgaagaagaagtccaaagacgccttcaggatttgcatcgtgtgattaatgaaggc
tgcagtacatctgcagacacgatgaaggataatgagaaacttcacaatggcaccattcaa
cgtaaactaaaatatgagcggatggtttctcgctctttgggcgcaaatccagatgacctg
aaggacccaattaaaattagtatcccacgctacgtcctctgcgggcaaggaaaggatgca
cacttcgagtttgaggtcaagattactgtcctagatgagacatggactgtattcaggcgt
tacagtcgttttcgagaaatgcataaaacattgaagttaaagtatgcagagcttgctgcc
cttgaatttcctccaaagaaactatttggaaataaggatgaacgtgtgattgctgagaga
cgaagtcacttagagaaatacctcagggactttttcagcgtgatgctccagtccacaaca
tctcccctccacatcaacaaagtgggactgactctctcgaaacataccatttgtgagttt
tcaccattcttcaagaaaggagtctttgactacagcagccacgggacggggtag

DBGET integrated database retrieval system