KEGG   Pan paniscus (bonobo): 100995010
Entry
100995010         CDS       T02283                                 

Gene name
PLCG1
Definition
(RefSeq) phospholipase C gamma 1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00562  Inositol phosphate metabolism
pps01100  Metabolic pathways
pps01521  EGFR tyrosine kinase inhibitor resistance
pps04012  ErbB signaling pathway
pps04014  Ras signaling pathway
pps04015  Rap1 signaling pathway
pps04020  Calcium signaling pathway
pps04062  Chemokine signaling pathway
pps04064  NF-kappa B signaling pathway
pps04066  HIF-1 signaling pathway
pps04070  Phosphatidylinositol signaling system
pps04072  Phospholipase D signaling pathway
pps04360  Axon guidance
pps04370  VEGF signaling pathway
pps04613  Neutrophil extracellular trap formation
pps04650  Natural killer cell mediated cytotoxicity
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04664  Fc epsilon RI signaling pathway
pps04666  Fc gamma R-mediated phagocytosis
pps04670  Leukocyte transendothelial migration
pps04722  Neurotrophin signaling pathway
pps04750  Inflammatory mediator regulation of TRP channels
pps04919  Thyroid hormone signaling pathway
pps04933  AGE-RAGE signaling pathway in diabetic complications
pps04935  Growth hormone synthesis, secretion and action
pps05012  Parkinson disease
pps05022  Pathways of neurodegeneration - multiple diseases
pps05135  Yersinia infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05205  Proteoglycans in cancer
pps05206  MicroRNAs in cancer
pps05214  Glioma
pps05223  Non-small cell lung cancer
pps05225  Hepatocellular carcinoma
pps05231  Choline metabolism in cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
Module
pps_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100995010 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100995010 (PLCG1)
   04014 Ras signaling pathway
    100995010 (PLCG1)
   04015 Rap1 signaling pathway
    100995010 (PLCG1)
   04370 VEGF signaling pathway
    100995010 (PLCG1)
   04064 NF-kappa B signaling pathway
    100995010 (PLCG1)
   04066 HIF-1 signaling pathway
    100995010 (PLCG1)
   04020 Calcium signaling pathway
    100995010 (PLCG1)
   04070 Phosphatidylinositol signaling system
    100995010 (PLCG1)
   04072 Phospholipase D signaling pathway
    100995010 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100995010 (PLCG1)
   04650 Natural killer cell mediated cytotoxicity
    100995010 (PLCG1)
   04660 T cell receptor signaling pathway
    100995010 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    100995010 (PLCG1)
   04659 Th17 cell differentiation
    100995010 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    100995010 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    100995010 (PLCG1)
   04670 Leukocyte transendothelial migration
    100995010 (PLCG1)
   04062 Chemokine signaling pathway
    100995010 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100995010 (PLCG1)
   04919 Thyroid hormone signaling pathway
    100995010 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100995010 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100995010 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    100995010 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100995010 (PLCG1)
   05206 MicroRNAs in cancer
    100995010 (PLCG1)
   05205 Proteoglycans in cancer
    100995010 (PLCG1)
   05231 Choline metabolism in cancer
    100995010 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100995010 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100995010 (PLCG1)
   05214 Glioma
    100995010 (PLCG1)
   05223 Non-small cell lung cancer
    100995010 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100995010 (PLCG1)
   05171 Coronavirus disease - COVID-19
    100995010 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100995010 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100995010 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100995010 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    100995010 (PLCG1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100995010 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100995010 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100995010 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pps04131]
    100995010 (PLCG1)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100995010 (PLCG1)
Membrane trafficking [BR:pps04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100995010 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100995010 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 GDPD PH_9
Other DBs
NCBI-GeneID: 100995010
NCBI-ProteinID: XP_003825944
Position
20
AA seq 1218 aa
MEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRI
SAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPF
LEASTLRAGERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPY
FFLDEFVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEA
YARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILS
IEDHCSIAQQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAY
EEVPTSMMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDE
EEPKEVSSSTELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFV
GDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMR
LSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKI
KHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYG
ALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGD
YGGKKQLWFPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNN
RLFVFSISMASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALE
LSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIY
PKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDE
AFDPFDKSSLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVG
QSVFPVILLILLGHCKPLPTSHPILSQGDLKPFVVAFTVDNGLNPVWPAKPFHFQISNPE
FAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDLELASLLIKIDIFP
AKQENGDLSPFSGTSLRERGSDAAGQLFHGRAREGSFESRYQQPFEDFRISQEHLADHFD
SRERRAPRRTRVNGDNRL
NT seq 3657 nt   +upstreamnt  +downstreamnt
atggaatttcgcctgaaaacgctgagcctgcaagccacatctgaggatgaagtgaacatg
tggatcaagggcttaacttggctgatggaggatacattgcaggcacccacacccctgcag
attgagaggtggctccggaagcagttttactcagtggatcggaatcgtgaggatcgtata
tcagccaaggacctgaagaacatgctgtcccaggtcaactaccgggtccccaacatgcgc
ttcctccgagagcggctgacggacctggagcagcgcagcggggacatcacctacgggcag
tttgctcaactgtaccgcagcctcatgtacagcgcccagaagacgatggacctccccttc
ttggaagccagtactctgagggctggggagcggccggagctttgccgagtgtcccttcct
gagttccagcagttccttcttgactaccagggggagctgtgggctgttgatcgcctccag
gtgcaggagttcatgctcagcttcctccgagaccccttacgagagatcgaggagccatac
ttcttcctggatgagtttgtcactttcctgttctccaaagagaacagtgtgtggaactcg
cagctggatgcagtatgcccggacaccatgaacaaccctctttcccactactggatctcc
tcctcgcacaacacgtacctgaccggggaccagttctccagtgagtcctccttggaagcc
tatgctcgctgcctgcggatgggctgtcgctgcattgagttggactgctgggacggcccg
gatgggatgccagttatttaccatgggcacacccttaccaccaagatcaagttctcagat
gtcctgcacaccatcaaggagcatgcctttgtggcctcagagtacccagtcatcctgtcc
attgaggaccactgcagcattgcccagcagaggaacatggcccaatacttcaagaaggtg
ctgggggacacactcctcaccaagcccgtggagatctctgccgacgggctcccctcaccc
aaccagcttaagaggaagatcctcatcaagcacaagaagctggctgagggcagtgcctac
gaggaggtgcctacatccatgatgtactctgagaacgacatcagcaactctatcaagaat
ggcatcctctacctggaggaccctgtgaaccacgaatggtatccccactactttgttctg
accagcagcaagatctactactctgaggagaccagcagtgaccagggcaacgaggatgag
gaggagcccaaggaggtcagcagcagcacagagctgcactccaatgagaagtggttccat
gggaagctaggggcagggcgtgacgggcgtcacatcgctgagcgcctgcttactgagtac
tgcatcgagaccggagcccctgacggctccttcctcgtgcgagagagtgagaccttcgtg
ggcgactacacgctctctttctggcggaacgggaaagtccagcactgccgtatccactcc
cggcaagatgctgggacccccaagttcttcttgacagacaacctcgtctttgactccctc
tatgacctcatcacgcactaccagcaggtgcccctgcgctgtaatgagtttgagatgcga
ctttcagagcctgtcccacagaccaacgcccacgagagcaaagagtggtaccacgcaagc
ctgaccagagcacaggctgagcacatgctaatgcgcgtccctcgtgatggggccttcctg
gtgcggaagcggaatgagcccaactcatatgccatctctttccgggctgagggcaagatc
aagcattgccgtgtccagcaagagggccagacagtgatgctagggaactcggagttcgac
agccttgttgacctcatcagctactatgagaaacacccgctataccgcaagatgaagctg
cgctatcccatcaacgaggaggcactggagaagattggcacagctgagcctgactacggg
gccctgtatgagggacgcaaccctggcttctatgtagaggcaaaccctatgccaactttc
aagtgtgcagtcaaagccctctttgactacaaggcccagagggaggacgagctgaccttc
accaagagcgccatcatccagaatgtggagaagcaagagggaggctggtggcgaggggac
tacggagggaagaagcagctgtggttcccatcaaactacgtggaagagatggtcaacccc
gtggccctggagccggagagggagcacttggacgagaacagccccctaggggacttgcta
cggggggtcttggatgtgccggcttgtcagattgccatccgtcctgagggcaagaacaac
cggctcttcgtcttctccatcagcatggcgtcggtggcccactggtccctggatgttgct
gccgactcacaggaggagctgcaggactgggtgaaaaagatccgtgaagtggcccagaca
gcagacgccaggctcactgaagggaagataatggaacggaggaagaagattgccctggag
ctctctgaacttgtcgtctactgccggcctgttcccttcgatgaagagaagattggcaca
gaacgtgcttgctaccgggacatgtcatccttcccggaaaccaaggctgagaaatacgtg
aacaaggccaaaggcaagaagttccttcagtacaatcgactgcagctctcccgcatctac
cccaagggccagcgactggattcctccaactacgatcctttgcccatgtggatctgtggc
agtcagcttgtggccctcaacttccagacccctgacaagcctatgcagatgaaccaggcc
ctcttcatgacgggcaggcactgtggctacgtgctgcagccaagcaccatgcgggatgag
gccttcgacccctttgacaagagcagcctccgcgggctggagccatgtgccatctctatt
gaggtgctgggggcccgacatctgccaaagaatggccgaggcattgtgtgtccttttgtg
gagattgaggtggctggagctgagtatgacagcaccaagcagaagacagagtttgtgggt
cagtctgtcttcccagtcatcctcctcatcctgctggggcactgcaagcctctccccacc
agtcatcccatcctctcccagggtgacctgaagccttttgtcgttgccttcacagtggac
aatggactcaaccctgtatggccagccaagcccttccacttccagatcagtaaccctgaa
tttgcctttctgcgcttcgtggtgtatgaggaagacatgtttagtgaccagaatttcctg
gctcaggctactttcccagtaaaaggcctgaagacaggatacagagcagtgcctttgaag
aataactacagtgaggacctggagttggcctccctgctgatcaagattgacattttccct
gccaagcaggagaatggtgacctcagtcccttcagtggtacgtccctgcgggagcggggc
tcagatgccgcaggccagctgtttcacggccgagcccgggaaggctcctttgaatcccgc
taccagcagccgtttgaggacttccgcatctcccaggagcatctcgcagaccattttgac
agtcgagaacgaagggccccaagaaggactcgggtcaatggagacaaccgcctctag

DBGET integrated database retrieval system