KEGG   Pan paniscus (bonobo): 100995228
Entry
100995228         CDS       T02283                                 

Gene name
CHUK
Definition
(RefSeq) conserved helix-loop-helix ubiquitous kinase
  KO
K04467  inhibitor of nuclear factor kappa-B kinase subunit alpha [EC:2.7.11.10]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps01523  Antifolate resistance
pps04010  MAPK signaling pathway
pps04014  Ras signaling pathway
pps04062  Chemokine signaling pathway
pps04064  NF-kappa B signaling pathway
pps04068  FoxO signaling pathway
pps04150  mTOR signaling pathway
pps04151  PI3K-Akt signaling pathway
pps04210  Apoptosis
pps04380  Osteoclast differentiation
pps04620  Toll-like receptor signaling pathway
pps04621  NOD-like receptor signaling pathway
pps04622  RIG-I-like receptor signaling pathway
pps04623  Cytosolic DNA-sensing pathway
pps04625  C-type lectin receptor signaling pathway
pps04657  IL-17 signaling pathway
pps04658  Th1 and Th2 cell differentiation
pps04659  Th17 cell differentiation
pps04660  T cell receptor signaling pathway
pps04662  B cell receptor signaling pathway
pps04668  TNF signaling pathway
pps04920  Adipocytokine signaling pathway
pps05010  Alzheimer disease
pps05132  Salmonella infection
pps05135  Yersinia infection
pps05142  Chagas disease
pps05145  Toxoplasmosis
pps05160  Hepatitis C
pps05161  Hepatitis B
pps05162  Measles
pps05163  Human cytomegalovirus infection
pps05164  Influenza A
pps05165  Human papillomavirus infection
pps05166  Human T-cell leukemia virus 1 infection
pps05167  Kaposi sarcoma-associated herpesvirus infection
pps05168  Herpes simplex virus 1 infection
pps05169  Epstein-Barr virus infection
pps05170  Human immunodeficiency virus 1 infection
pps05171  Coronavirus disease - COVID-19
pps05200  Pathways in cancer
pps05212  Pancreatic cancer
pps05215  Prostate cancer
pps05220  Chronic myeloid leukemia
pps05221  Acute myeloid leukemia
pps05222  Small cell lung cancer
pps05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pps05417  Lipid and atherosclerosis
pps05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pps00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100995228 (CHUK)
   04014 Ras signaling pathway
    100995228 (CHUK)
   04064 NF-kappa B signaling pathway
    100995228 (CHUK)
   04668 TNF signaling pathway
    100995228 (CHUK)
   04068 FoxO signaling pathway
    100995228 (CHUK)
   04151 PI3K-Akt signaling pathway
    100995228 (CHUK)
   04150 mTOR signaling pathway
    100995228 (CHUK)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100995228 (CHUK)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100995228 (CHUK)
   04621 NOD-like receptor signaling pathway
    100995228 (CHUK)
   04622 RIG-I-like receptor signaling pathway
    100995228 (CHUK)
   04623 Cytosolic DNA-sensing pathway
    100995228 (CHUK)
   04625 C-type lectin receptor signaling pathway
    100995228 (CHUK)
   04660 T cell receptor signaling pathway
    100995228 (CHUK)
   04658 Th1 and Th2 cell differentiation
    100995228 (CHUK)
   04659 Th17 cell differentiation
    100995228 (CHUK)
   04657 IL-17 signaling pathway
    100995228 (CHUK)
   04662 B cell receptor signaling pathway
    100995228 (CHUK)
   04062 Chemokine signaling pathway
    100995228 (CHUK)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100995228 (CHUK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100995228 (CHUK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100995228 (CHUK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100995228 (CHUK)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100995228 (CHUK)
   05221 Acute myeloid leukemia
    100995228 (CHUK)
   05220 Chronic myeloid leukemia
    100995228 (CHUK)
   05215 Prostate cancer
    100995228 (CHUK)
   05222 Small cell lung cancer
    100995228 (CHUK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100995228 (CHUK)
   05170 Human immunodeficiency virus 1 infection
    100995228 (CHUK)
   05161 Hepatitis B
    100995228 (CHUK)
   05160 Hepatitis C
    100995228 (CHUK)
   05171 Coronavirus disease - COVID-19
    100995228 (CHUK)
   05164 Influenza A
    100995228 (CHUK)
   05162 Measles
    100995228 (CHUK)
   05168 Herpes simplex virus 1 infection
    100995228 (CHUK)
   05163 Human cytomegalovirus infection
    100995228 (CHUK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100995228 (CHUK)
   05169 Epstein-Barr virus infection
    100995228 (CHUK)
   05165 Human papillomavirus infection
    100995228 (CHUK)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100995228 (CHUK)
   05135 Yersinia infection
    100995228 (CHUK)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100995228 (CHUK)
   05142 Chagas disease
    100995228 (CHUK)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100995228 (CHUK)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100995228 (CHUK)
   05418 Fluid shear stress and atherosclerosis
    100995228 (CHUK)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100995228 (CHUK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pps01001]
    100995228 (CHUK)
Enzymes [BR:pps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     100995228 (CHUK)
Protein kinases [BR:pps01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   100995228 (CHUK)
SSDB
Motif
Pfam: IKBKB_SDD Pkinase PK_Tyr_Ser-Thr IKKbetaNEMObind Pkinase_fungal Kdo TBK1_ULD
Other DBs
NCBI-GeneID: 100995228
NCBI-ProteinID: XP_003825511
Position
10
AA seq 745 aa
MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH
EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ
ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS
FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK
CIFACEEMSGEVRFSSHLPQPNSLCSLIVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC
FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI
SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI
IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL
EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE
IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV
LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ
SSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHL
STIIHEANEEQGSSMMNLDWSWLTE
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggagcggcccccggggctgcggccgggcgcgggcgggccctgggagatgcgggagcgg
ctgggcaccggcggcttcgggaacgtctgtctgtaccagcatcgggaacttgatctcaaa
atagcaattaagtcttgtcgcctagagctaagtaccaaaaacagagaacgatggtgccat
gaaatccagattatgaagaagttgaatcatgccaatgttgtaaaggcctgtgatgttcct
gaagaattgaatattttgattcatgatgtgcctcttctagcaatggaatactgttctgga
ggagatctccgaaagctgctcaacaaaccagaaaattgttgtggacttaaagaaagccag
atactttctttactaagtgatatagggtctgggattcgatatttgcatgaaaacaaaatt
atacatcgagatctaaaacctgaaaacatagttcttcaggatgttggtggaaagataata
cataaaataattgatctgggatatgccaaagatgttgatcaaggaagtctgtgtacatct
tttgtgggaacactgcagtatctggccccagagctctttgagaataagccttacacagcc
actgttgattattggagctttgggaccatggtatttgaatgtattgctggatataggcct
tttttgcatcatctgcagccatttacctggcatgagaagattaagaagaaggatccaaag
tgtatatttgcatgtgaagagatgtcaggagaagttcggtttagtagccatttacctcaa
ccaaatagcctttgtagtttaatagtagaacccatggaaaactggctacagttgatgttg
aattgggaccctcagcagagaggaggacccgttgaccttactttgaagcagccaagatgt
ttcgtattaatggatcacattttgaatttgaagatagtacacatcctaaatatgacttct
gcaaagataatttcttttctgttaccacctgatgaaagtcttcattcactacagtctcgt
attgagcgtgaaactggaataaatactggttctcaagaacttctttcagagacaggaatt
tctctggatcctcggaaaccagcctctcaatgtgttctagatggagttagaggctgtgat
agctatatggtttatttgtttgataaaagtaaaactgtatatgaagggccatttgcttcc
agaagcttatctgattgtgtaaattatattgtacaggacagcaaaatacagcttccaatt
atacagctgcgtaaagtgtgggctgaagcagtgcactatgtgtctggactaaaagaagac
tatagcaggctctttcagggacaaagggcagcaatgttaagtcttcttagatataatgct
aacttaacaaaaatgaagaacactttgatctcagcatcacaacaactgaaagctaaattg
gagttttttcacaaaagcattcagcttgacttggagagatacagcgagcagatgacgtat
gggatatcttcagaaaaaatgctaaaagcatggaaagaaatggaagaaaaggccatccac
tatgctgaggttggtgtcattggatatctggaggatcagattatgtctttgcatgctgaa
atcatggagctacagaagagcccctatggaagacgtcagggagacttgatggaatctctg
gaacagcgtgccattgatctatataagcagttaaaacacagaccttcagatcactcctac
agtgacagcacagagatggtgaaaatcattgtgcacactgtgcagagtcaggaccgtgtg
ctcaaggagctgtttggtcatttgagcaagttgttgggctgtaagcagaagattattgat
ctactccctaaggtggaagtggccctcagtaatatcaaagaagctgacaatactgtcatg
ttcatgcagggaaaaaggcagaaagaaatatggcatctccttaaaattgcctgtacacag
agttctgcccggtcccttgtaggatccagtctagaaggtgcagtaacccctcagacatca
gcatggctgcccccgacttcagcagaacatgatcattctctgtcatgtgtggtaactcct
caagatggagagacttcagcacaaatgatagaagaaaatttgaactgccttggccattta
agcactattattcatgaggcaaatgaggaacagggcagtagtatgatgaatcttgattgg
agttggttaacagaatga

DBGET integrated database retrieval system