KEGG   Pan paniscus (bonobo): 100996140
Entry
100996140         CDS       T02283                                 

Gene name
TPO
Definition
(RefSeq) thyroid peroxidase
  KO
K00431  thyroid peroxidase [EC:1.11.1.8]
Organism
pps  Pan paniscus (bonobo)
Pathway
pps00350  Tyrosine metabolism
pps01100  Metabolic pathways
pps04918  Thyroid hormone synthesis
pps05320  Autoimmune thyroid disease
Module
pps_M00043  Thyroid hormone biosynthesis, tyrosine => triiodothyronine/thyroxine
Brite
KEGG Orthology (KO) [BR:pps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100996140 (TPO)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100996140 (TPO)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100996140 (TPO)
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.8  iodide peroxidase
     100996140 (TPO)
SSDB
Motif
Pfam: An_peroxidase EGF_CA Sushi EGF_3 cEGF FXa_inhibition
Other DBs
NCBI-GeneID: 100996140
NCBI-ProteinID: XP_014199154
Position
2A
AA seq 979 aa
MRALAVLSVTLVMACTEAFFPFISRGKELLWGKPEESRVSSVLEESKRLVDTAMYATMQR
NLKKRGILSPAQLLSFSKLPEPTSGVIARAAEIMETSIQAMKRKVNLKTQQSQHPTDALS
EDLLSIIANMSGCLPYMLPPKCPNTCLANKYRPITGACNNRDHPRWGASNTALARWLPPV
YEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVSNEVVTDDDRYSDLLMAWGQYIDHD
IAFTPQSTSKAAFGGGADCQMTCENQNPCFPIQLPEEARPAAGTACLPFYRSSAACGTGD
KGALFGNLSTANPRQQMNGLTSFLDASTVYGSSPALERQLRNWTSAEGLLRVHARLRDSG
RAYLPLAPPRAPAACAPEPGIPGETRGPCFLAGDGRASEVPSLTALHTLWLREHNRLAAA
LKALNAHWSADAVYQEARKVVGALHQIITLRDYVPRILGPEAFQQYVGPYEGYDSTTNPT
VSNVFSTAAFRFGHATIHPLVRRLDASFQEHPDLPGLWLHQAFFSPWTLLRGGGLDPLIR
GLLARPAKLQVQDQLMNEELTERLFVLSNSSTLDLASINLQRGRDHGLPGYNEWREFCGL
PRLETPADLSTAIASRSVADKILDLYKHPDNVDVWLGGLAENFLPRARTGPLFACLIGKQ
MKALRDGDWFWWENSHVFTDAQRRELEKHSLSRVICDNTGLTRVPVDAFQVGKFPEDFES
CDSIPGVNLEAWRETFPQDDKCGFPESVENGDFVHCEESGRRVLVYSCRHGYELQGREQL
TCTQEGWDFQPPLCKDVNECADGAHPPCHASARCRNTKGGFQCLCADPYELGDDGRTCVD
SGRLPRATWISISLAALLIGGFAGLTSTVICRWTLLPRDCPPPGPSFPRPLGQRQPESLE
MESEASGHLNCMLMTGIVFRTSLGKSEGTGPLLGDRRRVASLSYTAWGIRTCCSGIPQSQ
CGVCEALRPQRTWGRTCAP
NT seq 2940 nt   +upstreamnt  +downstreamnt
atgagagcgctcgctgtgctgtctgtcacgctggttatggcctgcacagaagccttcttc
cccttcatctcaagagggaaagagctcctttggggaaagcctgaggagtctcgtgtctct
agcgtcttggaggaaagcaagcgcctggtggacaccgccatgtacgccacgatgcagaga
aacctcaagaaaagaggaatcctttctccagctcagcttctgtctttttccaaacttcct
gagccaacaagtggagtgattgcccgagcagcagagataatggaaacatcaatacaagcg
atgaaaagaaaagtcaacctgaaaactcaacaatcacagcatccaacggatgctttatca
gaagatctgctgagcatcattgcaaacatgtccggatgtctcccttacatgctgccccca
aaatgcccaaacacttgcctggcgaacaaatacaggcccatcacaggagcttgcaacaac
agagaccaccccagatggggcgcctccaacacggccctggcacgatggctccctccagtc
tatgaggacggcttcagtcagccccgaggctggaaccccggcttcttgtacaacgggttc
ccactacccccggtccgggaggtgacaagacatgtcattcaagtttcaaatgaggttgtc
acagatgatgaccgctattctgacctcctgatggcatggggacaatacattgaccacgac
atcgcgttcacaccacagagcaccagcaaagctgccttcgggggaggggctgactgccag
atgacttgtgagaaccaaaacccatgttttcccatacaactcccggaggaggcccggccg
gccgcgggcaccgcctgtctgcccttctaccgctcttcggccgcctgcggcaccggggac
aaaggcgcgctctttgggaacctgtccacggccaacccgcggcagcagatgaacgggttg
acctcgttcctggacgcgtccaccgtgtatggcagctccccggccctagagaggcagctg
cggaactggaccagtgccgaagggctgctacgcgtccatgcgcgcctccgggactccggc
cgcgcctacctgcccttagcgccgccacgcgcgcctgcggcctgtgcgcccgagcccggc
atccccggagagacccgcgggccctgcttcctggccggagacggccgcgccagcgaggtc
ccctccctgacggcactgcacacgctgtggctgcgcgagcacaaccgcctggccgcggcg
ctcaaggccctcaatgcgcactggagcgcggacgcggtgtaccaggaggcgcgcaaggtc
gtgggcgctctgcaccagatcatcaccctgagggattacgtccccaggatcctgggaccc
gaggccttccagcagtacgtgggtccctatgaaggctatgactccaccaccaaccccact
gtgtccaacgtgttctccacagccgccttccgcttcggccacgccacgatccacccgctg
gtgaggaggctggacgccagcttccaggagcaccccgacctgcccgggctgtggctgcac
caggccttcttcagcccatggacactcctccgtggaggtggtttggacccactaatacga
ggccttcttgcaagaccagccaaactgcaggtgcaggatcagctgatgaacgaggagctg
acggaaaggctctttgtgctgtccaattccagcaccttggatctggcgtccatcaacctg
cagaggggccgggaccacgggctgccaggttacaatgagtggagggagttctgcggcctg
cctcgcctggagacccccgctgacctgagcacagccatcgccagcaggagcgtggccgac
aagatcctggacttgtacaagcatcctgacaacgtcgatgtctggctggggggcctagct
gaaaacttcctccccagggctcggacagggcccctgtttgcctgtctcattgggaagcag
atgaaggctctgcgggacggtgactggttttggtgggagaacagccacgtcttcacggat
gcacagaggcgtgagctggagaagcactccctgtctcgggtcatctgtgacaacaccggc
ctcaccagggtgcccgtggatgccttccaagttggcaaattccccgaagactttgagtct
tgtgacagcatccctggcgtgaacctggaggcctggagggaaacctttcctcaagatgac
aagtgtggcttcccagagagcgtggagaatggggactttgtgcactgtgaggagtctggg
aggcgcgtgctggtgtattcctgccggcacgggtatgagctccaaggccgggagcagctc
acttgcacccaggaaggatgggatttccagcctcccctctgcaaagatgtgaacgagtgt
gcagacggtgcccaccccccctgccacgcctctgcgaggtgcagaaacaccaagggcggc
ttccagtgcctctgcgcggacccctacgagttaggagacgatgggagaacctgcgtagac
tccgggaggctccctcgggcgacttggatctccatctcgctggctgctctgctgatcgga
ggcttcgcaggtctcacctcgacggtgatttgcaggtggaccctcctccccagggactgt
cctcccccagggccctctttccccagacccttggggcagagacagcctgagtctcttgag
atggagtctgaagcttctggtcatctgaactgcatgttgatgacaggaattgtcttcagg
acgtcattagggaagtccgagggaactggccctttgctgggggacagacgtagagtggcc
agcctgagctacacagcatgggggatccgaacctgttgtagtggaatccctcagagtcaa
tgcggcgtctgtgaggcactcaggccccagaggacctggggaaggacctgtgctccttag

DBGET integrated database retrieval system