KEGG   Pseudomonas resinovorans: PCA10_p0310Help
Entry
PCA10_p0310       CDS       T02708                                 

Gene name
carC
Definition
(GenBank) 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase
  KO
K15756  2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoate hydrolase [EC:3.7.1.13]
Organism
pre  Pseudomonas resinovorans
Pathway
pre00621  Dioxin degradation
pre01100  Metabolic pathways
pre01120  Microbial metabolism in diverse environments
pre01220  Degradation of aromatic compounds
Module
pre_M00544  Carbazole degradation, carbazole => 2-oxopent-4-enoate + anthranilate
Brite
KEGG Orthology (KO) [BR:pre00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00621 Dioxin degradation
    PCA10_p0310 (carC)
Enzymes [BR:pre01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.13  2-hydroxy-6-oxo-6-(2-aminophenyl)hexa-2,4-dienoate hydrolase
     PCA10_p0310 (carC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1057 FSH1 Peptidase_S9 Peptidase_S15 Abhydrolase_2 Lipase_2 BAAT_C
Motif
Other DBs
NCBI-ProteinID: BAN51415
UniProt: S6AQD6
Position
pCAR1.3:30770..31642
Genome map
AA seq 290 aa AA seqDB search
MLNKAEQISEKSESAYVERFVNAGGVETRYLEAGKGQPVILIHGGGAGAESEGNWRNVIP
ILARHYRVIAMDMLGFGKTAKPDIEYTQDRRIRHLHDFIKAMNFDGKVSIVGNSMGGATG
LGVSVLHSELVNALVLMGSAGLVVEIHEDLRPIINYDFTREGMVHLVKALTNDGFKIDDA
MINSRYTYATDEATRKAYVATMQWIREQGGLFYDPEFIRKVPVPTLVVHGKDDKVVPVET
AYKFLDLIDDSWGYIIPHCGHWAMIEHPEDFANATLSFLSRRADITRAAA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgttaaataaagctgaacaaatctcggaaaagtccgaaagtgcgtatgtcgaacgcttt
gttaatgcgggcggtgttgaaacccgctatctcgaagccggcaaagggcagcccgtcatc
ttgatccatggagggggtgcgggagcggagagcgaaggtaattggagaaacgtcatcccc
attcttgctcgtcactatcgtgtgattgctatggacatgcttggctttggtaagaccgca
aagcctgacatcgaatatacgcaggaccgccgcattcgtcacttgcacgattttattaaa
gcgatgaacttcgacggcaaggtctcgattgtgggaaattcgatgggtggcgcaaccggc
ctcggtgtgtctgttcttcactctgaactcgtcaatgcactggtgctcatgggaagcgca
ggcctcgtagtagaaatccacgaagatctgcgccccatcatcaactacgatttcacacgt
gagggtatggtccatttggtcaaggcacttaccaacgatggattcaagatcgacgatgcg
atgatcaactcgcgctatacctacgcgaccgatgaagctacgcgcaaagcctacgtagcg
acaatgcagtggattcgcgaacagggcggacttttctacgatcccgagttcattcggaaa
gttccggtgccgacccttgtggtgcacgggaaagatgacaaggtagttccagttgaaact
gcatacaagtttcttgatctcatcgatgacagctggggctacatcatccctcactgcggc
cactgggcgatgatcgaacatccagaggactttgcgaacgcaactctgtcgttcctttct
cgtcgtgcagacattacccgtgctgccgcataa

DBGET integrated database retrieval system