KEGG   Planococcus rifietoensis: AUC31_10105Help
Entry
AUC31_10105       CDS       T04201                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
prt  Planococcus rifietoensis
Pathway
prt00450  Selenocompound metabolism
prt00970  Aminoacyl-tRNA biosynthesis
prt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:prt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AUC31_10105
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AUC31_10105
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:prt01007]
    AUC31_10105
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:prt03016]
    AUC31_10105
Enzymes [BR:prt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AUC31_10105
Amino acid related enzymes [BR:prt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AUC31_10105
Transfer RNA biogenesis [BR:prt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AUC31_10105
 Prokaryotic type
   Other AARSs
    AUC31_10105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 Zn-ribbon_8 zf-Mss51
Motif
Other DBs
NCBI-ProteinID: ALS75533
UniProt: A0A0U2YRT3
Position
3233548..3235515
Genome map
AA seq 655 aa AA seqDB search
MTAKNKTFYLTTPIYYPSGKFHIGTAYTTVASDAMARYKRLRGFDVRFLTGMDEHGQKIE
EKAREAGKEPQVFVDDMAEAAKKVWEVMDISYDDFIRTTEARHKEGVEKIFQTFLDNGDI
YKGEYEGWYCTPCESFFTESQLEDGNCPDCGRPVHKVKEESYFFNMKKYADRLLDYYDKH
VEFIEPESRKNEMVNNFIKPGLEDLSVSRTSFDWGIPVPGDPKHVIYVWVDALSNYITSL
GYGSNDDSNFNKYWPADVHVVGKDIVRFHTIYWPIFLMALDLPLPKKVFAHGFIMMKDGK
MSKSKGNVVYPEMLVERYGLDAARYFLLRELPFGSDGVFSPESFVERTNYDLANDLGNLL
NRTVSMINKYFDGSVPQVNGFKTDFDETLQTVAKNTVAVYEEHMEKMQFSLVLSEVWTLI
SRTNKYIDETQPWVLAKDDGDRTQLASVMAHLAESLRMTAVMLQPFLPNAPKQIIEQLGL
TPEFLEWQTLESFGAIPSGTTVVKKGTPIFPRLEVEPEVAYIRDQMRGGAAPKEEQAPVE
TVPEKPDTPEITIDDFMKVDLRVATVTACEPVKKTDKLLKLQVDMGYETRQVVSGIAEHY
KPDELVGRKVIIVANLKPVKLRGELSQGMILAGQQNGYLTIASVDQKLPNGTQVK
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccaagaacaagacattttacctgacgactcccatttattatccgagcggaaaa
ttccatatcggaacggcttacacgaccgttgcatccgacgccatggcgcgttataaacgc
ttgcgcggcttcgatgtccgttttttgacgggcatggatgagcacggccagaaaattgaa
gagaaagcccgcgaagccggcaaagaaccgcaagtctttgtcgatgatatggctgaggcg
gcgaaaaaagtatgggaagtcatggacatcagctatgacgactttatccgcacgactgaa
gcccgccataaggaaggcgtggagaaaattttccaaaccttcctcgacaatggcgatatc
tacaaaggcgaatacgaaggctggtattgcacgccttgtgaatccttcttcacggaatct
cagctagaagacggcaattgcccggattgcggacgcccggtgcataaagtgaaagaagaa
tcgtatttcttcaatatgaaaaagtacgcagaccgcttgcttgattattacgataagcat
gtcgaattcatcgagccggaatcgcgtaaaaatgaaatggtcaataatttcattaagccg
ggccttgaagatttgtcggtttcccggacttcattcgactggggcatcccggttcctgga
gatccgaagcatgtcatctatgtatgggtcgatgcgttgtcgaattacatcacgtcactc
ggctatggttcgaatgatgattccaatttcaataaatactggccggcagacgtccacgtc
gtcggaaaagacatcgtgcgcttccatacgatctattggccgatcttcctcatggcgctt
gacttgccattgccgaagaaagtcttcgcacatggcttcatcatgatgaaagacggcaaa
atgtcgaaatcgaaaggcaatgtcgtctatccggaaatgcttgtggagcgctacgggctg
gatgcggcgcgttatttcctattgcgcgaactgccatttggatctgacggcgtgttctcg
ccggaatcttttgtcgagcgtaccaattacgacttggcgaacgatctcggcaacttgctg
aaccgcactgtctcgatgatcaataaatatttcgacggttcagtgccgcaagtcaatggc
ttcaagaccgacttcgacgagactttgcagacggtggcaaaaaacaccgttgctgtttac
gaagagcatatggaaaaaatgcagttcagcctcgtgttgagcgaagtgtggacattgatt
tcgcgcacgaataaatacatcgatgaaacgcagccgtgggtattggcgaaagatgatggc
gatcgcacgcagcttgcatcggtcatggcgcatctcgcggaaagcttgcgcatgacagcg
gttatgctgcagccgttcttgccgaatgcaccaaagcagatcatcgaacagctcggcctt
acgccggagttccttgaatggcagacattagagtcattcggtgcgattccttcaggtacg
accgtcgtgaaaaaaggcacgccgattttcccgcgtctcgaagtggaaccggaagtggcg
tatattcgcgaccaaatgcgcggaggggcagcgccgaaagaagaacaagcacctgttgag
accgtcccggaaaagccggacacccccgagattacgatcgatgatttcatgaaagtggat
ttacgcgtagcgacggttacggcatgcgaaccggtgaagaagaccgataagctattgaag
ctgcaagtggacatgggctatgaaacacggcaagtcgtctccggcattgcggagcattac
aagccggatgagctcgtcggccgaaaagtcatcattgtcgccaacttgaaaccggtcaag
ctgcgcggagaattatcgcaaggcatgattctcgccggccagcaaaatggctacttgacc
atcgcttccgtagaccaaaagttaccgaacggcacacaagttaagtaa

DBGET integrated database retrieval system