KEGG   Planococcus rifietoensis: AUC31_15025Help
Entry
AUC31_15025       CDS       T04201                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
prt  Planococcus rifietoensis
Pathway
prt00520  Amino sugar and nucleotide sugar metabolism
prt01100  Metabolic pathways
prt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:prt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AUC31_15025
Enzymes [BR:prt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     AUC31_15025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ALS76432
UniProt: A0A0U2XJU2
Position
complement(2232940..2234100)
Genome map
AA seq 386 aa AA seqDB search
MKNSLLISGITIADAVEESVIGDILIEDGKISRVAEKIEVPADIHIEASGKNWTAFPGFI
DVHIHGAAGHDSMDATPEDLAGLAEALPKEGTTSFLATTMTQSDEAISAALENICEFHAS
EGQAEMLGVHLEGPFISAERAGAQPIEHIVEASYPLFREWQKKSGNQIRLVTLAPETRGA
MEFIKKLTEDKVIASIGHSDATFEEVQAAVRSGANHVTHLYNQMSPFHHRKPGVVGAALM
EDGLMVELIADFIHSHPASVEMAFRQKGAERLILITDAMRAKGLPPGVYDLGGQDVQVTK
KDARLADGTLAGSILTMDRAIQNVQSITGCSVNELVAMTSANAANELGLANKGKVCSGAD
ADIAILDDNLNVQLTICRGTIAYRKE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaacagcctattgatttcgggcatcaccattgcagatgcggtggaagaaagtgtt
atcggggatatcctcatcgaagacggcaaaataagccgcgtggccgaaaagattgaagtg
ccagctgacattcatatagaagcaagcggtaaaaactggactgcgtttcctggatttatc
gacgtccatattcacggcgcggcagggcacgattcgatggacgcgacgccagaagacttg
gctggcttagcggaagctttgccgaaagaaggaacgaccagttttctcgcgaccacgatg
acgcaatcggatgaggccatttcagcagcgctggaaaatatctgtgagtttcatgctagt
gaagggcaggcggagatgctcggcgttcatttggaaggaccgtttatttctgctgaacgt
gcaggggcgcagccgattgaacatatcgtcgaagcgtcgtatcccttatttcgcgaatgg
caaaaaaagagcggcaaccagatccgtttggttactttagcgccagaaacccggggcgcc
atggagtttatcaaaaaactgacggaggataaggtcattgcctccatcggccattccgat
gccacttttgaggaagtacaggcagccgttcgttccggcgcgaaccacgtgacgcatctc
tataaccaaatgagcccgttccatcatcgcaagccgggtgttgtgggtgcggcgttgatg
gaagatggcttgatggtcgaactcattgccgatttcattcacagccatcccgcttccgtc
gaaatggcgtttcggcaaaaaggagccgagcgcttaatattgattaccgatgccatgcgc
gcaaaaggcttgcccccaggtgtctatgatttaggcggacaggatgtgcaggtgacgaaa
aaagacgcacggcttgcggatggaaccttagctggcagcatcttgacgatggacagagcg
attcagaatgtgcagtctatcaccggctgcagcgtaaatgaattggtggccatgacgtcc
gccaatgccgcaaacgaattgggattagccaataaaggcaaagtctgtagcggtgcggat
gcggatatcgccattttagatgacaatttgaacgttcaattgaccatttgcagaggaaca
atcgcctacaggaaggaatga

DBGET integrated database retrieval system