KEGG   Psychrobacter sp. PRwf-1: PsycPRwf_0122
Entry
PsycPRwf_0122     CDS       T00541                                 

Definition
(GenBank) hypothetical protein
Organism
prw  Psychrobacter sp. PRwf-1
SSDB
Motif
Pfam: DpnD-PcfM DUF1980
Other DBs
NCBI-ProteinID: ABQ93082
UniProt: A5WBP1
Position
complement(145518..145718)
AA seq 66 aa
MAPKAKRYKVEVTEVLSTIVEVMASTEEEAIKKVKKAYRQEQIVLSDEHYVQTEFELNTD
KDNSNH
NT seq 201 nt   +upstreamnt  +downstreamnt
atggcgccaaaagccaaacgttataaggtagaggtgacagaggttttatcaacaatcgtt
gaagtcatggcaagtacagaagaggaggctataaagaaggtgaaaaaggcataccgacaa
gagcaaatcgtattaagtgatgagcattatgtacaaacagaatttgagttaaatacggac
aaagacaattctaaccactga

DBGET integrated database retrieval system