KEGG   Pseudoalteromonas sp. SM9913: PSM_B0236
Entry
PSM_B0236         CDS       T01374                                 

Definition
(GenBank) Transcriptional Regulator, MerR family protein
  KO
K13639  MerR family transcriptional regulator, redox-sensitive transcriptional activator SoxR
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:psm03000]
    PSM_B0236
Transcription factors [BR:psm03000]
 Prokaryotic type
  Helix-turn-helix
   MerR family
    PSM_B0236
SSDB
Motif
Pfam: MerR-DNA-bind MerR_1 MerR HTH_31 HTH_3 TPR_MLP1_2 NFRKB_winged SinI Morc6_S5 HTH_15
Other DBs
NCBI-ProteinID: ADT70276
Position
II:complement(264194..264652)
AA seq 152 aa
MAVQKKLTEANLTVGFVAKRSGVKVSTLHFYETKGLIRSWRNSGNQRRFKPDVLRRVAVI
KAAQAMGITLEEIKQTLATLPEQRTPTQKDWSALSKQWQAQLDERIAYMQRLRERVDGCI
GCGCLSMSKCPIYNKDDHLGETQSGAILLERD
NT seq 459 nt   +upstreamnt  +downstreamnt
atggcggtacaaaaaaagcttactgaagccaacttaacggttgggtttgtcgctaaacgc
agtggcgttaaggtatctacactgcacttttacgaaactaaagggctaatacgcagttgg
cgaaacagtggcaaccaacgacgttttaaaccagatgtactaaggcgagtcgcagttata
aaagcggcacaagcgatggggatcacgctggaagaaattaaacaaacactggcaacgtta
ccagagcagcgcacacctacccaaaaagactggtctgcactttcaaaacaatggcaagca
cagcttgatgagcgcattgcttacatgcaacgtctacgtgagcgggttgatggctgtatt
ggctgtgggtgtttatcaatgagtaagtgccctatttataacaaagacgaccacttaggt
gaaacccaaagtggtgccattttgttagagcgagattaa

DBGET integrated database retrieval system