KEGG   Pseudoalteromonas sp. SM9913: PSM_B0241
Entry
PSM_B0241         CDS       T01374                                 

Definition
(GenBank) transcription regulator, LacI family protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 Peripla_BP_4 LacI HTH_10 KR HTH_3 HTH_26 HTH_24 HTH_IclR HTH_11 HTH_Crp_2 HTH_38 Sigma54_DBD HTH_36 DUF2316 HTH_AsnC-type MarR
Other DBs
NCBI-ProteinID: ADT70281
Position
II:268970..269977
AA seq 335 aa
MNNKKIKLADLAKLAGVSTSTVSRALNNNPLIKQETRDKLQQLAKKHNFSLNTAASRLRT
QKTNVVAVIINLDEQTEQSISDPFLLKVVSEINLALNQQGLELLLSNSIMAQDDWANYFI
NGRRADGIIVVGQGKNQTNIEAAADAGIPLVVWGDPKTQSNYPIVGSDNYLGGMQATAHL
IEHGAKNILFLGDPEHGEISERHRGYAAALSTHKLEQHVISIDLTSRSAYQAINQLLREK
GLYFDAIMACSDMVALGAMKALKERYVSIPNDVALVGFDDIAMADISHPSLSTIKQNTQF
AATLLVKKLIQQFSGEKVESQVIDIELITRQSSKR
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgaataataaaaaaattaaattagctgatttagcaaagcttgctggggtgtctacctca
acggtttcgcgcgcgctgaataataacccgctcattaagcaagaaacccgcgacaagctt
cagcagcttgcaaaaaaacataattttagccttaacacggcggctagccgtttgcgtacg
caaaagaccaatgttgttgccgtcattattaatcttgatgagcaaaccgagcaatcaatc
agcgatccatttttactcaaggtagtgagcgaaattaaccttgcgcttaatcaacagggg
ttagagttgttgttatctaactctattatggcgcaagatgactgggctaattactttatt
aatggccgccgagcagatggcattattgttgtggggcaaggaaaaaaccaaactaatata
gaagcggctgccgatgcaggtattcctttagttgtatggggggatccaaaaacacaaagc
aattatcctattgtcggcagcgataactacttaggaggaatgcaagcgaccgctcattta
atagaacacggtgctaaaaatattttatttttaggcgatcctgagcatggtgaaattagt
gaaaggcatcgtggttacgctgctgcactttctacccataaacttgagcagcatgttata
tccattgatcttaccagtcgctctgcgtatcaagcaattaatcaattattacgtgaaaaa
gggttgtattttgacgcgattatggcctgtagtgacatggttgcactgggggcgatgaaa
gcgctgaaagagcgctacgtgagtattcccaacgatgtggctctggttggatttgatgac
attgccatggctgatatcagccatccttcactttctacaattaaacaaaacacccaattt
gctgcgactttgttagttaaaaagttaatacaacagttttcaggtgaaaaagtcgaatca
caagttattgatatagagttaattactcgccagtcaagcaaacgttaa

DBGET integrated database retrieval system