KEGG   Pseudoalteromonas sp. SM9913: PSM_B0251
Entry
PSM_B0251         CDS       T01374                                 

Definition
(GenBank) deseasin MCP-01
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Peptidase_S8 P_proprotein PKD_4 PKD Inhibitor_I9 DUF3791 DUF5011
Other DBs
NCBI-ProteinID: ADT70291
Structure
PDB: 
3VV3

Position
II:277445..279952
AA seq 835 aa
MKTKLSIITLALLPCLAAAKLPDVNSTTQKVTASSDSIIVKYKKNASPKMRKQARSLVKA
KISDLNNDEIDDNFTSLFSGRLAKFKISGMSAKEAIERLKSHQAIEYVEPDYRVSIASAT
NDPRFDDLWGLNNEGQTGGTADADIDAPEAWSISTGSRDVVVGVIDTGVDYSHPDLAANA
WVNSGEIAGDGIDNDGNGYIDDVHGINAITDVGDPMDDEGHGTHVSGTIGASGNNGVGVV
GVNHDVSIVGCKFLAADGTGSTSGAIKCIDYMVGLKNAGVNLRVLNNSWGGGGFSQALAD
AITASEQADILFVAAAGNDAVDNDQNPHYPSNYENDNVLSIASTDSRDNMSSFSQWGLTS
VDMGAPGSGILSTVPGNSYATYSGTSMATPHVAGAAALVLSVNPDLTTLELKELLMSSGD
ANAALNGKTVAGTRLNVNQALIDADPTPGFKLSVSPVSQQATVGDTVTYTFTIGSIAQWE
GDVSLALASDLTDASLSATTARPGDEVVLTVATNSDTQWGNYDFTVTATTEEQVKEQTVS
LMLQPAGLNDFTYSSDENIAIPDNSPEGASSVITVADDLTIFGTTADVDITHTWSGDLVL
TLISAQGTEVTLQSNEGGSADDIVKSFTSSVFNSEVATGDWTLHVEDTAGADTGNINGWS
LTFSAIGEVSPQPPQAGFSVSAQGLTATFVDTSRDVNDDISQWSWNFGDGSTSTNPNPTH
VYAQSGSYEVELTVTDSENNSDTFTQTVVVSDVEIELSLKRANKSRLDTMRVELNWAEVG
AESLSLYRNGELVDTVSDNGRYRDYVRNATLPAYDYQLCVSENVCSNIITVSFSE
NT seq 2508 nt   +upstreamnt  +downstreamnt
atgaaaacaaaattatctattattacacttgcacttttaccttgtttagctgcggctaaa
ttgcctgatgttaacagtacaactcaaaaagtaactgcgagcagtgactcgattattgtt
aagtataaaaagaatgcttcgccgaaaatgcgtaagcaagctcgttcgttagtaaaagcc
aaaatatctgatctaaataacgatgaaattgatgataacttcacctcgttattttctggc
cgcctcgcaaaatttaaaatatcaggaatgagcgctaaagaagcaattgagcgcttaaaa
tcgcatcaagctattgagtatgttgagcctgattaccgagtgagcatagcaagcgcaact
aatgaccctcgttttgatgatttatggggcttaaacaacgaaggccaaactggtggcacg
gctgatgccgatattgatgcaccagaagcatggtcaatctctacaggtagtcgtgatgtt
gtagtaggtgttattgatacgggtgttgattatagtcaccctgatttagctgcgaacgcg
tgggtaaacagtggtgaaattgccggtgatggtatcgataatgacggaaacggttacatt
gatgacgttcacggtattaatgcaattactgatgttggtgatccgatggatgacgaaggc
catggtacacacgtatcgggtacaatcggtgccagtggtaacaatggtgtcggtgttgtt
ggtgtaaaccatgatgtttctattgttggttgtaagtttttagccgcagatggtacaggt
tctacctctggtgctattaagtgtatcgattacatggttggccttaaaaatgcgggtgtt
aatctgcgtgtgttaaataatagctggggcggcggtggttttagccaagcgttagctgat
gcgattacggctagtgagcaagctgatattttatttgttgctgctgcgggtaacgatgcg
gttgataacgatcaaaatccacactacccatctaattatgaaaacgacaacgtattatcg
atagctagtactgatagcagagataatatgtctagcttttctcaatggggcctaacaagt
gttgatatgggcgcacctggctcaggtattttgtcgaccgttcctggtaatagctatgct
acttattcaggtacatctatggcaacaccgcatgtagctggtgctgctgcacttgtactt
tcagttaatcctgatttaacaacactagagcttaaagaattacttatgtctagtggtgat
gctaatgcggcattaaatggtaaaacggttgcaggtacacgcctaaatgttaaccaagcg
ctaattgatgctgatccaactccaggctttaaattatctgtatcgccggtttctcagcaa
gcgactgtaggtgatacggttacttatacctttacgattggctcaattgcacaatgggaa
ggtgacgtttcactggctttagcttcagatcttaccgatgcatcactaagcgcaactacc
gctcgtccgggcgatgaagttgttctaacggttgcaactaacagcgatactcagtgggga
aattacgactttactgttaccgcaacaactgaagagcaagttaaagaacaaactgttagc
ttaatgcttcaacctgctggtttaaatgactttacttacagcagtgatgaaaacatcgct
attccagataattctccagagggcgcaagctcagttattacggttgctgatgatttaact
atttttggcaccactgctgatgtagatattacgcatacttggtctggtgacttagtactt
acgcttatttcagcgcaaggtacagaagtaactttacaaagcaatgaaggtggcagtgca
gacgatattgttaagtcatttacatcaagcgtatttaattctgaagtggcaaccggagat
tggacacttcatgttgaagatacagctggtgcagatacgggtaatatcaatggttggtca
cttacatttagcgctattggtgaggtaagcccacaaccaccacaagctggctttagtgtt
tcagcacaaggtttaactgctacatttgtagatacaagtcgtgatgtaaatgatgacatt
tcacagtggagctggaactttggtgatggttcaacatcaacaaacccaaatcctacacat
gtttacgctcagtcaggaagttatgaggttgaattaaccgtaacggatagtgaaaataac
tcagatacattcactcaaacagtggttgttagtgatgttgaaattgaattgagcttaaaa
cgcgctaacaagtcacgtcttgatactatgcgtgttgagttaaactgggcagaagtaggg
gctgagtcacttagcctataccgaaatggcgaactagtagataccgtatcagataatggc
cgttaccgtgattatgtgcgtaacgcaacattaccggcatacgactatcagttatgcgta
tctgaaaacgtatgttcgaatattattacggtttcattttctgaataa

DBGET integrated database retrieval system