KEGG   Pseudoalteromonas sp. SM9913: PSM_B0265
Entry
PSM_B0265         CDS       T01374                                 

Definition
(GenBank) Transcriptional regulator
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Peripla_BP_3 LacI Peripla_BP_1 HTH_10 HTH_23 HTH_11 HTH_3 MRP-L20 ACT HTH_38 Sigma70_r4 GerE HTH_35 HTH_AraC
Other DBs
NCBI-ProteinID: ADT70305
Position
II:complement(299482..300513)
AA seq 343 aa
MSKPTRWTLKSIAKELGVSNATVSNAFNRPDQLSAKRREAILKACKELGYYGPNKAAQSL
RSGTFNIVALVLPDSVEYMVSDPVASSFMRGVTSVLEKNNINVLLFSGNSDNLNSVVDFV
DGFICYGRPRNKALVEQLKTVSKHVVTVDFDIARNASINVNNEQASYEIAKHVLHNQNDK
VAILGLRLLDENVLCRVYEHHEFETGQSISHQRLRGYQRALSEANITVADDRIWNIPESS
ERFANIAAKEVLTASPRPNVIICMSDLIALATMREAIKQGIKIGSELRIVGFDGIEEAAR
FVPRLTTIHQNSQEKGVMAANLFISKEEKQYEVGYALDIGASS
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgagtaaacccacccgctggacattaaagagtattgccaaagaattaggtgtgtctaat
gctacggtatcaaatgcgtttaatcgcccggatcaactctctgctaaacgccgcgaagcc
atacttaaagcgtgcaaagagctggggtattatggccctaataaagcggcgcagtctttg
cgaagtggcacgtttaatattgttgcattagtccttcctgatagcgtggaatacatggta
tcagaccctgttgcgagcagttttatgcggggagtaacctctgtacttgaaaaaaacaat
attaatgttttattgttttcaggcaatagtgacaacctcaacagcgttgttgattttgtc
gatggttttatttgttatggtcgcccgcgcaataaagcactagtagagcaactaaaaaca
gtctctaaacatgtggtgacggttgattttgacattgcccgtaacgcctcaattaatgtt
aataacgagcaagccagttatgaaatagccaaacatgttttgcataatcaaaatgataaa
gtggctatattaggtttaagattacttgatgaaaatgtattgtgccgggtatacgaacat
cacgaatttgaaactggccaatctatttcgcatcaacgtttgcgtggttatcaacgcgcc
ttaagtgaagctaatataacggttgccgacgaccgcatttggaatattcctgaaagcagt
gagcgctttgcaaatattgccgcaaaagaggtattaacagcctcccctcgccctaacgtg
attatatgcatgagtgatttaattgcccttgccaccatgcgagaagccataaaacaaggg
ataaaaataggcagtgagctgcgtattgtggggtttgatggcatagaagaagccgctcgt
tttgtacctcgccttactacaattcatcaaaatagccaagaaaagggcgttatggctgct
aacttatttatttccaaagaagaaaaacaatatgaagtaggttacgcactcgatattggt
gcaagtagctaa

DBGET integrated database retrieval system