KEGG   Pseudoalteromonas sp. SM9913: PSM_B0288
Entry
PSM_B0288         CDS       T01374                                 

Definition
(GenBank) peptidase S9 prolyl oligopeptidase
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Peptidase_S9 DPPIV_N DLH Hydrolase_4 Peptidase_S9_N Peptidase_S15 Esterase Esterase_PHB LIP FSH1 AXE1
Other DBs
NCBI-ProteinID: ADT70328
Position
II:complement(326334..328382)
AA seq 682 aa
MLKTSLALAIGLSSSVAFAQSAITVEDIPKIKSVIQTSVSPDGDNVAFTRSLPRTLYVDE
NGSNYSELYVVDDKGVERPFITGSVNIKSIEWSNDSKTIYFLAKLKDDKFTSLYQIPVDG
GQAQPVLALKDTSISSYKLSPDNKQVAILAMPAADKSEKELKKLGFKAEVYEMGLKNKQL
FIVDLAKADKPLTPTALNVDNYVSDVNWAANGEKLLVKTQPTALIDDKYTKSMWHLFDIA
SNKVTLSFKTEGKLGDAELSHDGKYIAILGAEDKHDPATGRLFIADTKTAEITEWLPDFM
GHVVDFEWSHKRNTLNFIANVGTQSFVASIKTGSNKYKKLVNEGEFIASQLSVSDSDKTL
ALRGNTAKHPNEVFIVRSNKATRLTDSNSWLNDKRFAKQETITLKARDGVELDGVLVYPL
DYEKGTRYPLIMSVHGGPESHDKDGWVTNYSRPGQMGAARGYAVFYPNYRGSTGKGVDYS
KLGQNDYAGKEFDDLVDFKNHLVDMGLVDTKRVGITGGSYGGYASAWGATKLTKHFAASV
MFVGVTNQLSKFGTTDISNEMNLVHARSYPWDKWQWYLERSPIYWAGQSETPLLIMHGKD
DPRVHPAQSMELYRYMKVQGKDVRLVYYPGEGHGNRKVAAQYDYSLRLMRWMDNYLMEGK
KEMPAFEIDHAAKLKEVKDANK
NT seq 2049 nt   +upstreamnt  +downstreamnt
atgctaaaaactagcttagcgctggcaattgggctttcaagctcagttgcatttgcgcaa
tcggccatcactgttgaagacattccaaaaattaaatctgtgatccaaaccagtgttagc
ccagatggcgacaacgttgcgtttacacgatcgttaccgcgtacattatatgttgatgag
aatggcagtaattacagtgagctttatgttgttgatgataaaggcgttgaacgtcctttc
attaccggctcggttaatattaaaagcatagaatggtcaaacgacagtaaaacaatttat
tttttagccaagctaaaagacgataaatttacctcgttatatcaaatccctgttgatggc
ggccaagcacaacctgttcttgctttaaaagacacatcaatttcaagctacaaattaagc
ccagacaacaaacaggtggctattttagcgatgcctgcagcagacaagtcagaaaaagaa
cttaaaaaacttgggtttaaagctgaagtatatgaaatgggcttaaagaacaagcagctt
tttattgttgacttagctaaagcggataaaccacttacccccaccgcactcaacgttgat
aactacgtgagtgacgttaattgggctgctaatggtgaaaagctactggttaaaactcaa
cccacggcactgattgatgataaatacacaaaatctatgtggcatttgtttgatattgct
agcaataaagtaaccttatcgtttaaaactgaaggcaagctaggtgatgcagagctgtcg
catgatggtaaatacattgctattttaggtgcagaagataagcacgaccctgcaacaggc
cgcttatttattgctgacactaaaaccgctgaaatcactgaatggttacctgactttatg
ggtcacgttgttgattttgaatggtcgcataagcgtaatacacttaactttattgccaat
gtaggcacgcaaagttttgtagcgagcattaaaacgggctctaataaatacaaaaaatta
gtcaacgaaggtgaatttattgcctcacaattgagtgtttcagattcagataaaacactc
gcacttcgtggtaataccgcaaaacaccctaacgaagtgtttattgtgcgcagtaataaa
gcaacacgtttaaccgattcaaatagctggttaaatgataaacgctttgccaagcaagaa
accattacccttaaagcacgcgacggcgttgagcttgatggcgtgctcgtttacccatta
gattatgaaaaaggcacacgctacccactgattatgtcggtacacggtggccctgaaagc
catgataaagacggctgggtcactaactactcacgcccaggtcaaatgggtgcagcacgt
ggctatgcggtgttttatcccaactaccgaggctctacaggtaaaggcgtagattactca
aaattaggccaaaacgattacgcaggtaaagagtttgacgatttagttgattttaaaaat
caccttgttgatatgggtttagtagacactaaacgtgttggtattactgggggatcttac
ggtggttatgcatcggcgtggggcgcaacaaaactaaccaaacactttgctgcaagcgtt
atgtttgtgggtgtcaccaaccaactgtctaaatttggtactactgatatttctaacgaa
atgaacctagttcatgcgcgttcatacccatgggataaatggcagtggtacttagaacgc
agccctatttactgggcaggccaatctgaaacacctctgcttattatgcacggtaaagac
gaccctcgcgttcaccctgcacaatctatggagctttaccgctacatgaaagtgcaaggt
aaggatgtacgtcttgtttattacccaggtgaaggtcatggtaaccgtaaagtggcagcg
caatacgactacagcttgcgtttaatgcgctggatggacaactatttaatggaaggcaaa
aaagagatgcctgcgtttgaaattgaccatgctgctaagttaaaagaagtcaaagacgca
aataaataa

DBGET integrated database retrieval system