KEGG   Pseudoalteromonas sp. SM9913: PSM_B0291
Entry
PSM_B0291         CDS       T01374                                 

Definition
(GenBank) hypothetical protein
Organism
psm  Pseudoalteromonas sp. SM9913
SSDB
Motif
Pfam: Peptidase_S9 Peptidase_S15 Abhydrolase_6 DLH FSH1 Band_7_1 PAF-AH_p_II Abhydrolase_2
Other DBs
NCBI-ProteinID: ADT70331
Position
II:331593..334043
AA seq 816 aa
MNAFRLFIALVGCIVLLPASYAEQGYQTPSPALAALVDAKLAPTSSLSNDGQWLALFERK
RVVSLDELAKEEFKLAGIKLNPANFSRSRVSAKYSALELKHVQSGTVINVNNLPQGIIRS
PRWSANSEHLAFIVEQPDNARLWVYSVKTKQAKQLSELALNSVLTATPYQWLPDSTAIVA
NLAVNLDKPRLTNDTQSTVPVIQQSTGEKAPARTYQNLLTSPFDEAQFKFYGQGQLAYIT
LDGKAQPIGRAGLFKSFSISPDSTNILVATIDEPFSYQVPYSRFATTWQIWGMRGYALVE
LAKQPLADNIPQGYDSVRTGRRDFEWRADQGAEVIWAEAQDGGDMKTEVEYHDYLYSLRA
PFKRDPKLFAKVERRFAGIQWGNDNIAMLSDWRFSDRQVRTYVIQPRNADSNRVLFSERS
YNDAYKDPGSAIYERNDLGVSVIKVVGGRYIYLRGDGASEQGNIPFLDQYDVKTNSTKRL
WQSAAPYYERVRALLDDEGTKFITIRESKSQQPNFFIRDLDKGSLTQLTQFEHPYPAFKG
VTKEQLRYTRDDGVELSGTLYLPPGYDKTQGPLPVLMWAYPLEYKDKAVASQVRESEYEF
TYIGYWGPMPYLAKGIAVFDDPKMPIVGVDGSEPNDHFRKQLVSSAKAAVDVLVEKGIAD
KDNIAIAGHSYGAFMVANLLAHSDLFKVGIARSGAYNRTLTPFGFQGEERDFWQAQSVYA
NMSPFFHAEKINEPMLMIHGQEDPNSGTFPMQSERMYAALKGLGKEARLVMLPYEAHGYR
ARKSLLHVLWEQEQWLDKYLLKDNVEPVDMDEQPIQ
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgaatgcttttaggctatttattgccttggtaggctgcattgttttattgcctgcaagt
tatgcagagcaaggatatcaaaccccttcaccggcgcttgcggcactcgtagatgctaag
ttagcaccaactagctctttatcaaatgatggtcaatggcttgctctgtttgaacgcaag
cgtgttgtgtcgcttgatgagctggccaaagaagaatttaagcttgcgggaattaagctt
aatcctgctaacttttcacgctcacgggtaagtgcaaagtacagcgcgttagagcttaag
catgttcaaagtggaacagtaataaacgttaataatttgcctcaggggattattcgctcg
ccgcgttggtcagcaaatagcgaacatttagcgtttattgttgaacaaccggataacgca
cggctatgggtttatagcgttaaaaccaaacaagctaagcagttaagtgagcttgcactt
aattcagtattaaccgctacgccttatcagtggttacccgatagcacggcgattgtggct
aatttagcggtaaacttagacaaaccaagattaaccaatgatacccaaagcacagtgccg
gttattcaacaaagtactggcgaaaaagccccagcaaggacttatcaaaacttattgacc
agcccgtttgatgaagcacaatttaaattttatggtcaaggtcaattagcgtatatcacg
cttgatggcaaagcacagccgattggccgtgccggtttatttaaatcgttttcaatttcg
cctgattcaaccaatattttagtcgcgaccatcgacgagccattttcgtatcaagtccct
tacagtcgttttgcaactacatggcaaatatggggaatgcgtggctatgcattagtagag
ctggcaaagcaacctcttgccgacaacattccacaaggctacgacagtgtgcgtacaggt
cgtcgtgattttgagtggcgagccgatcaaggtgctgaagtcatatgggccgaggcacaa
gatggcggtgatatgaaaactgaggttgaatatcatgactacctttacagtttacgagcg
ccatttaaacgcgaccctaaattatttgccaaagtagagcgtcgttttgcgggtatacaa
tggggtaatgataatattgccatgctaagtgattggcgttttagtgaccgacaagtgcgc
acttatgtaattcaaccacgtaatgccgatagtaaccgcgtgttattttcagagcgcagt
tataacgatgcctataaagatccaggcagtgcaatttacgagcgtaacgatttaggtgtt
agcgtaataaaagttgttggcggacgttacatttacttacgtggcgatggcgcgtctgag
caaggaaacattccttttttagatcagtacgatgttaaaacgaatagcaccaaacgttta
tggcaatcagcagcgccttattacgagcgtgtgcgtgcattgttagacgatgaaggcaca
aaattcattactattcgtgagtctaaatcgcagcagccaaacttttttattcgcgattta
gataaaggctcgctaacacagcttactcagtttgagcatccttaccctgcatttaaaggc
gtaaccaaagagcaactacgttatacccgtgatgacggtgttgagctttcaggtacgctt
tatttaccaccagggtatgacaaaacacaagggccattaccggtattgatgtgggcatat
ccacttgaatataaagataaagcagttgcatcacaagtgcgtgaatctgaatacgaattt
acctacataggttattggggccctatgccttaccttgcgaaagggattgcggtgtttgat
gatcctaaaatgccgattgtaggcgttgatggcagtgagccaaatgatcactttagaaaa
cagctagtctctagtgctaaagcagcggttgatgtactggttgaaaagggcattgccgat
aaagataacattgctatagcagggcattcgtatggtgcgtttatggtggctaatttatta
gcacatagcgatttatttaaggtaggtattgcccgcagtggtgcgtataaccgcacatta
acgccgtttggttttcagggtgaagaacgtgatttttggcaagcacaaagtgtgtacgca
aacatgtcgccgtttttccatgctgaaaaaattaacgaacctatgttaatgatccacggt
caagaggaccctaattcgggcacttttccaatgcaaagtgagcgtatgtacgcagcgctt
aaaggcttgggtaaagaagcgcgtttagtgatgcttccttacgaagctcatggctaccgt
gcccgtaaaagcttattacatgtactgtgggagcaagagcaatggcttgataagtacttg
ttaaaggataatgttgaaccagttgatatggacgaacaacccattcaatag

DBGET integrated database retrieval system