KEGG   Pseudoalteromonas sp. SM9913: PSM_B0308
Entry
PSM_B0308         CDS       T01374                                 

Definition
(GenBank) transposase IS3/IS911 family protein
  KO
K07483  transposase
Organism
psm  Pseudoalteromonas sp. SM9913
Brite
KEGG Orthology (KO) [BR:psm00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    PSM_B0308
SSDB
Motif
Pfam: HTH_Tnp_1 HTH_23 HTH_3 HTH_28 HTH_29 SpoIIID HTH_40 DUF134 HTH_Tnp_IS630 HTH_31 HTH_17 Sigma70_r4 HTH_36 HTH_Crp_2 Phage_CII LZ_Tnp_IS481 P22_Cro Abhydrolase_9 CENP-B_N Sigma70_r4_2 Phage_CI_repr HTH_1 Fe_dep_repress YdaS_antitoxin Phage_terminase Takusan LacI
Other DBs
NCBI-ProteinID: ADT70348
Position
II:complement(352451..352774)
AA seq 107 aa
MGEKMTKLKRATYSAAIKLETAQLVVDQGYTQEDAAKAMGVGKSTVSKWVTQLKQERNGQ
SPSASPMTPEQIEIRELKKQIQRIELEKDILKKATALLMSDSLNNSR
NT seq 324 nt   +upstreamnt  +downstreamnt
ttgggtgaaaaaatgacgaaattaaaacgcgcaacatactctgcggcaatcaaattagaa
acggctcagcttgtggtggaccaaggttatacacaagaagatgcagccaaggctatgggg
gtgggtaaatcaaccgtcagtaaatgggttacccaattaaagcaagagcgtaatggtcag
tcaccatctgcttcgccaatgacgcccgaacaaattgaaatccgcgaacttaaaaagcaa
atccaacgcattgaattagaaaaggatatattaaaaaaggctaccgctctcttgatgtcc
gactccctgaacaattctcgttaa

DBGET integrated database retrieval system