KEGG   Pseudohongiella spirulinae: PS2015_2207
Entry
PS2015_2207       CDS       T04158                                 

Definition
(GenBank) hypothetical protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
pspi  Pseudohongiella spirulinae
Pathway
pspi00230  Purine metabolism
pspi01100  Metabolic pathways
pspi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pspi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PS2015_2207
Enzymes [BR:pspi01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     PS2015_2207
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C AAA_3
Other DBs
NCBI-ProteinID: ALO46842
UniProt: A0A0S2KEW8
Position
2404877..2407315
AA seq 812 aa
MTYKHIGKNFTPPDIEAKVTGTARYAEDFKKEGMVFARLLTSPLPAGRVVSIDYSEALAM
EGVVGILTTEDLPQAAPPANPPLASDVIAYLGQPILAIAAVTEEIAENAIEKVRIEFERR
PFVVDPLDTLVEGGPNPYPNGNTLIRNAAAAAAGTTQSGTDVGEIKWSRDAVAAFRAGRE
PSNVTWGDQWEFGDLDAAFAECSVIVEEPFVTIGQPHHALEPRSGMAYWENGRCYFHGSL
QSHTIAVAPLAGMLGIDPANLVFINEYTGGGFGGKIFPYPIMAVTGHLARKINRPVQLRI
TREEEFYIGHARAGMQGLMKLGLKPDGKVGAVDVIVIGDAGAGGGASGSGAARFVSLMVQ
PEAMRFRGVSLYTNTSPRAAQRGPGENEMATVLDPILDKAIRQAGLDRAQVRIMNAPDSN
GLIGPQRGTLTGAWMPQAIAQAAEMFGWEEKRQLSGRRNGNKVTGIGIGMGYHSAGASGY
DGLCRIGTDGKLYLHTGVGNLGTYSYAAVVRTAAEVLKVDWENCEIVRGNTDLHLPYSTF
QAGSNTMFTEVRTNYVAAQDALRKLKAIAASELGGEPDDYDIDGARVFLTSNPDQGLTYA
EAAQRAVSMGGEYSGQQYPDDLNPVTKRAVEGLAGTGLIGVAKDSRHSGTVPAFTVGFME
IELDTMTGKYDILDYTAVADCGTIIHPMGFRQSMNGGGVWGVGLAGYERLVYDTQNGLPA
NIGLYQAKIPTFLDIPHVTHSDATNMADPQSPMGSRGVGEPAQGSACAALASAISDALGH
QFNRYPVTPDMIVNHVAGLDSFNTGDLKSNTF
NT seq 2439 nt   +upstreamnt  +downstreamnt
atgacatacaagcacataggtaaaaactttacgccaccggatatcgaagccaaagtcacc
ggtacggcgcgctatgcagaagatttcaaaaaagaaggcatggtgttcgcccgactgctg
accagcccgctgccggctggccgggttgtcagtattgattactcagaagctctggcaatg
gaaggcgtggtaggtatcctgactaccgaggacctgccgcaggcggccccacccgcaaac
cccccgctggcatccgatgtcatcgcctatctgggacagccgattctcgcaattgcggcc
gtgacagaagagattgctgagaatgccattgagaaagtccggatcgaattcgaacgtcgc
ccgtttgttgttgatcccctggacactctggtcgaaggcggccccaacccctatccaaat
ggtaataccctgattcgcaacgccgcagcagccgcagcaggcacaactcagtccggtacc
gatgtcggcgagatcaaatggtctcgcgacgccgttgccgccttccgcgccggccgcgag
ccgagcaacgtgacctggggagatcagtgggagtttggtgacctggatgcagcctttgct
gagtgctcggtcatcgttgaagagccatttgttaccataggccaaccccaccacgcgctg
gaaccgcgcagcggcatggcatactgggaaaacggtcgctgctacttccacggttcactg
cagagtcacacaatcgctgttgctccgctggcgggcatgctgggcattgacccggccaat
ctggtcttcatcaacgaatacaccggcggtggtttcggcggcaagatcttcccgtatccc
atcatggctgttaccggccatctggcccgcaagatcaatcgtccggtacaactgcgcata
acccgtgaagaagaattttacatcgggcacgcgcgagctggtatgcagggcctcatgaag
ctgggcctgaaacctgacgggaaagttggcgcagtggatgtcatcgtaattggtgatgcc
ggtgctggcggcggggccagtggttctggcgctgcacgtttcgtttcactgatggtccag
cccgaagcgatgcgcttccgtggtgtatcactgtataccaacacctcacctcgagccgcc
cagcgcgggcccggtgagaacgagatggcaactgtgcttgacccgattctcgacaaagcc
atcagacaggccggactggaccgggcacaggtcagaatcatgaatgcgcccgacagcaac
ggcctgattggcccgcagcgcgggaccctgactggcgcctggatgccgcaggcgatcgct
caggcggcagagatgtttggctgggaagagaaaagacaattgtccggacgtcgaaacggc
aacaaggtgactggcattggaatcggtatgggctatcactctgccggtgccagcggatat
gacggattgtgccgtatcggcacggacggcaaactgtacctgcatacaggtgtaggcaac
ctgggcacctactcttacgctgcagtcgtccgaacggccgcagaagtgctcaaggtagac
tgggaaaactgtgaaattgttcgcggcaataccgatcttcacctgccctacagcactttc
caggcaggcagtaacaccatgttcaccgaagtgcgcacaaactacgtagccgcgcaggat
gcattgcgcaaactgaaagcgattgctgccagtgagctgggtggtgaacctgacgactac
gatattgacggagcgcgggtgttcctgaccagcaatccggaccagggtctgacctatgcc
gaggcggcgcaacgtgccgtgtcaatgggtggcgaatatagcggtcagcagtatcctgac
gatctgaatccggtcaccaagcgtgccgtagaaggtcttgccggaacagggctgattggt
gtagccaaggactctcgccacagcggtaccgtcccggcattcactgtcggcttcatggaa
atcgagctcgataccatgaccggcaaatacgacatcctcgattacactgccgtggcagat
tgtggcaccatcattcacccgatgggcttccgccagagcatgaacggtggtggcgtatgg
ggtgttggcctggcaggctacgaacgtctggtgtatgacacccagaacggactgccggcc
aacatcggactgtatcaggccaagattccgacattcctggatatcccgcatgttacccac
agtgatgccactaatatggctgacccgcaaagcccgatggggtcacgcggtgtgggtgag
ccggcacaaggcagcgcctgcgcggcacttgccagtgccatctctgatgcattgggacac
cagttcaatcgctacccggttacccctgacatgattgtgaatcacgttgcagggctggat
agcttcaataccggcgatctgaaatcgaatacattctga

DBGET integrated database retrieval system