KEGG   Pseudoalteromonas spongiae: PSPO_a1856Help
Entry
PSPO_a1856        CDS       T05098                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pspo  Pseudoalteromonas spongiae
Pathway
pspo00520  Amino sugar and nucleotide sugar metabolism
pspo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pspo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSPO_a1856 (nagA)
Enzymes [BR:pspo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     PSPO_a1856 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ATC98888
UniProt: A0A290T3L2
Position
I:complement(1750199..1751326)
Genome map
AA seq 375 aa AA seqDB search
MSATKYFATRLFSGEQFVQNVTFSVEDGVITAFEQGQTENAIVLEGTVVPGFIDVQVNGG
GGAFFNAEQSVNCVDAIAKAHGQFGTTALLPTLITDSVEVMERAADATAQAIKDQVPGIV
GVHFEGPHLSMPKKGTHSEKFIRPITEAEFAVFERQDLGIKVVTLAPENVSASDIKRLVA
AGVKVSIGHTNADYPTVLAALEAGADGFTHLYNAMSAFTSREPGVVGAALTDTNAWCGLI
VDGHHVHPVSAKFAIDSKTRGKIMLVTDAMPPVGTNDMEFDFFDGRKVIRTGDRLNSTTG
ELAGSVLDMAGAVRNTINTLDVSYAEALRMASLYPAQYLGLGNRKGRLVVGADADFVVMD
NEFYARETYVAGAKR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcagctacgaagtattttgcgacacgcttatttagcggtgaacagtttgttcaaaat
gtgacgtttagtgttgaagatggcgtgatcacagcgtttgagcaaggtcaaactgaaaat
gcgattgtacttgaaggcaccgttgttccgggctttatcgatgtacaagtcaatggcggt
ggtggtgcattttttaacgccgagcaaagtgtaaattgcgtcgatgcgattgcaaaagcg
catggccaatttggtacaactgcattattaccaacccttatcacagacagtgttgaagta
atggaacgagcagctgacgccacagctcaggcaattaaagatcaagtgccgggtattgtg
ggcgtgcattttgaaggcccgcatttatcaatgccgaaaaagggcacgcatagcgaaaaa
tttattcgcccaattactgaagcggaatttgcagtatttgaacgccaagatttaggcatc
aaggtagttaccttagcgccagaaaatgtgtctgccagcgacattaaacgccttgttgca
gcgggtgtgaaagtatctattggtcacactaatgctgattatccaacggtattagccgca
cttgaagccggtgctgacggttttacccatttatataacgcgatgagtgcgttcacttct
cgtgaaccaggtgtagttggggcagcattaactgacaccaacgcatggtgcggcttaatt
gttgacggtcatcatgttcacccagtatctgcaaaatttgctatcgatagcaaaacccgt
ggcaaaattatgctagtaacagatgcgatgccacctgtgggtactaacgatatggagttt
gacttctttgatggtcgtaaagtgatccgcactggcgatagattaaattcaaccacaggt
gaattagcaggcagcgtgttagacatggcaggtgcggtgcgcaataccattaatactctt
gatgttagttatgctgaagcactgagaatggcatcactttacccagcacagtacctaggt
ttaggtaatagaaaagggcgattagtggttggcgcagatgctgactttgtggtgatggac
aatgaattttatgcacgagaaacctatgttgctggtgcaaagcgataa

DBGET integrated database retrieval system