KEGG   Pelodiscus sinensis (Chinese soft-shelled turtle): 102457684
Entry
102457684         CDS       T02980                                 

Gene name
SIM1
Definition
(RefSeq) single-minded homolog 1
  KO
K09100  single-minded
Organism
pss  Pelodiscus sinensis (Chinese soft-shelled turtle)
Brite
KEGG Orthology (KO) [BR:pss00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pss03000]
    102457684 (SIM1)
Transcription factors [BR:pss03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102457684 (SIM1)
SSDB
Motif
Pfam: SIM_C PAS_3 PAS PAS_11 HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 102457684
NCBI-ProteinID: XP_025038111
Ensembl: ENSPSIG00000002579
Position
Unknown
AA seq 762 aa
MKEKSKNAARTRREKENSEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRVVFPEGL
GEAWGHTSRTSSLDNVGRELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPADHDEMTAVLTAHQPYHSHFVQXXXXXXSFFLRMKCVLAKRNAGLTCGGY
KVIHCSGYRKTRQYSLDMSPFDGCYQNVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDM
KLIFLDSRVAELTGYEPQVLFLPLDRDLVAFPSIFFSSAVLVKGQVTTKYYRFLAKHGGW
VWVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYKGLQLSLDQVTATKPSFSYANSTPTIT
DNRKGSKSRLSSTKSKSRTSPYPQYSGFHTERSESDHESQWGGSPLTDTASPQLMEPAER
PSSQHHDVSCAYRQYSDRSSLCYGFALDHSRLTDDRHFHTQACEGGRCEAGRYFLGTPQP
GRDTWWGSRTTLPLTKISPESRETYENSMPHITSVHRIHGRGHWDEESVVSSPDPGSASE
SGDRYRTEQYQSSPHEPSKIETLIRATQQMIKEEENRLQLQKTTPDQLVSINGAGKKHSI
CFANYQQQQLTGDVCRVPTVANTSPCEHVQQRDGKIMSPHENDYDNSPTTLSRISSPNSD
RISKSSLILAKNYLHSDMSPHQTTGDHPGASPNYYTSHRQYFDKHAYTLTGYALEHLYDS
ETIRNYSLGCNGSHFDVTSHLRMQQDPAQGHKGTSVIITNGS
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgaaagagaagtccaaaaatgctgcccggactagacgggagaaagaaaacagtgaattt
tatgaactggctaaattactgcctttgccctccgctatcacctctcagctggataaagca
tcaataatcagactcaccaccagctatttaaaaatgagggtggtttttcctgaaggactt
ggagaagcttggggccatactagtcgaaccagctctttggataatgttggacgggaactg
ggatcccatcttttgcagaccttggatggtttcatatttgttgtggctccagacggcaag
atcatgtacatttcagagacggcctccgttcacctgggtttatcacaggtagagctgacc
ggaaacagcatttacgagtacatccacccggcggaccacgatgagatgacggcggtgctc
acagctcaccagccctatcactctcacttcgtgcagnnnnnnnnnnnnnnnnnctccttt
ttcctgaggatgaaatgcgtcttggctaagcggaatgcggggctgacctgcggggggtac
aaggtcattcattgcagcggctaccggaagacccgccagtacagcctggacatgtccccc
ttcgatggctgctaccagaacgttggcttggtcgctgtgggccactcgctgcctcccagc
gcggtgacggagatcaagctgcacagcaatatgttcatgttccgggccagcctggacatg
aagctcatcttcttagattccagggtggctgagctgacaggttacgagccgcaggttctc
tttctccctctagaccgggacctggttgcttttccttctatttttttctcttctgcagtg
ctggtgaaagggcaagtgaccaccaaatattaccgcttcctggccaaacacggcggctgg
gtgtgggtgcagagctatgccactatcgtgcacaacagcaggtcctcacggccacactgc
atagtcagtgtcaactacgtcctcacggataccgaatataaaggactacaactctccttg
gatcaagtgacagcaaccaagccatcattctcatatgcaaattcaactccaaccataaca
gacaatagaaagggaagcaaatcacggctctcaagcaccaagtcaaaatcaaggacatca
ccgtatccacagtactctggatttcacacagaaagatctgaatctgaccatgagagccaa
tggggtggaagtccactaactgatactgcctctccacaactaatggaacctgccgaaaga
ccaagctctcagcaccacgatgtttcctgtgcttatagacagtactcagaccgcagctct
ctctgctatggttttgcattggaccattccaggttgactgatgatagacatttccatact
caggcctgtgaaggaggcaggtgtgaggctggtagatatttcctgggcacacctcagcct
ggaagggatacttggtggggttctcgtacaacattgccactgacaaaaatttcccctgaa
agcagagaaacatatgaaaacagcatgccccacatcacttcagtgcacaggatacatggg
agaggacactgggatgaggagagtgttgttagctccccagatcctggctctgctagtgaa
tcaggagaccgataccgtactgagcagtatcaaagtagtccacatgagcccagcaaaatt
gaaactctaataagagctacccagcaaatgattaaagaagaagaaaacaggcttcagcta
cagaaaacaaccccggatcagctagtctccattaatggagcagggaaaaagcactctatt
tgttttgcaaattaccagcaacagcagttgacgggggatgtctgtcgggttcctacagtt
gccaacacctctccttgtgaacacgttcagcaacgagatggaaagattatgagcccgcac
gaaaacgactatgacaacagtcccacaacactgtctaggataagtagcccaaattctgac
cgcatttctaaatctagtttgatattagctaaaaactacctgcattcagacatgtcccct
catcaaaccacaggggaccatccaggtgcttctccaaactattacacttctcacaggcag
tactttgacaagcatgcgtacacgttaactggatatgctctggagcatctatatgacagt
gaaaccattagaaactattccttgggctgtaatggatcacactttgatgtgacttctcac
ttaaggatgcagcaagatccagcacaaggacacaaggggacatccgttataataaccaat
ggaagctga

DBGET integrated database retrieval system