KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0861Help
Entry
PSPTO_0861        CDS       T00118                                 

Definition
(RefSeq) hypothetical protein
Organism
pst  Pseudomonas syringae pv. tomato DC3000
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YabA TSC22 Gluconate_2-dh3 UPF0242 DivIVA ZYG-11_interact CHASE3 Filament Enkurin Atg14
Motif
Other DBs
NCBI-GeneID: 1182490
NCBI-ProteinID: NP_790701
UniProt: Q889A0
Position
complement(932461..933957)
Genome map
AA seq 498 aa AA seqDB search
MKSNPLLKYLVVPLLLLTVFIGIKMMRGGPEQQADNAPAPKLTAEQAKALGVEGDTPSDT
LRTVVAEGRELKQQITDVMAQNSAVKQDNEALKQRLANIDQTVEQRLKNAQEQFKLDSQQ
QQQSVLDGLRKQMDELTRMGQNGATHPDLPIGLGVQQGDGQQFKSDSSGSDLMWINPQDA
TALDSNGKPITAGNSVPASAYSFPTAFGESVDRGQKALTTGAQSVRDDMGGQQQERKKVR
RAYTLPQNSTLMGSVAMSALIGRVPVDGTVNDPYPFKVLIGPDNLTANGIDLPDVAGAVA
SGTASGDWTLSCVRGQIKSLTFVFNDGTVRTLPAPVQGGNQQNNNQNNQNNSGDQQPIQG
GLGWISDPYGIPCIAGERRSNAQQYIGSQALITAAGAGAASLIKTEGSTSSYVSNASGTL
GSTGLSGNEAMGKILTQGVTDVSSWVNKLYGQAFAAIYVLPGAQVSLHIDQELEIDYELK
GRKVKYASGANHANANLD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtaacccgctgctcaagtacctggtggttccgcttctcctgctcacggtgttc
atcggcatcaagatgatgagaggtggacccgaacagcaggctgacaacgcaccggcccca
aaactcacagcggaacaggccaaggctctgggtgtggaaggcgacacgccgagcgacacg
ctacgcacggtcgtggctgaagggcgcgagctcaagcagcagatcaccgatgtgatggcg
cagaactcagccgtcaagcaggacaacgaggcgctcaaacaacgattggcgaacatcgat
cagacggtagagcagcgtctgaagaatgcccaggagcagttcaagctcgacagtcagcag
caacagcagagcgtgctggatggcttgcgcaaacagatggatgaactgacccggatggga
caaaacggcgctacgcacccggatctaccgattggcctgggcgttcagcagggagatggt
caacagttcaagtccgactcaagcggttcggacctcatgtggatcaatccacaggacgcg
acggccctagacagtaacggtaaaccgatcactgctggcaatagcgtccccgcgagcgcc
tacagctttcctacagcctttggcgaatcggtagaccgaggacagaaagccctgacgaca
ggcgctcagtctgtccgcgatgacatgggtggccagcaacaggagcgcaagaaggtacgt
cgtgcctacaccctgcctcaaaactcgacgttgatggggtcggtggccatgtccgcgttg
atcggccgggttcctgttgatgggacggttaatgacccctacccgttcaaggtgctgatc
ggtccggacaacctgacggccaatggcatcgaccttcctgacgtagccggtgcggtggcc
agcggtacagcgtcaggcgactggaccctctcatgcgtgcgggggcagatcaaaagcctg
accttcgtgttcaacgatgggactgtccgtacgttacccgccccagtccagggcggtaat
cagcagaataataaccagaacaatcagaacaactctggagaccagcaacccatccagggc
gggctcggatggatcagtgatccctacggcattccgtgcatcgccggcgagcgacgcagc
aatgcgcagcagtacatcggctcacaagccctgattaccgcagcaggtgctggagcagcc
tcgttgatcaagaccgaaggaagcacctcctcttacgtctcgaacgcttctgggacgctg
ggtagcaccggtttgtctggtaacgaggcgatgggcaaaattctcactcaaggcgtcacg
gacgtgtccagctgggtcaacaaactgtatggccaggcgtttgcggccatctacgtctta
cctggtgcgcaggtctcactgcacatcgatcaagagctggaaattgactacgaactcaaa
ggccgcaaggtcaaatacgcctcaggagcgaaccatgccaatgccaacctggattga

DBGET integrated database retrieval system