KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22650
Entry
UIB01_22650       CDS       T03366                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00626  Naphthalene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Module
pstu_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    UIB01_22650
Enzymes [BR:pstu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     UIB01_22650
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AHY45199
UniProt: A0A023WZF9
Position
pLIB119:58081..59085
AA seq 334 aa
MSNKTMKPARLTAEDIHGVWAIMPTPATPDASNWRSTNTVDLNETARIVEELIAAGVNGI
LSMGTFGECATLTWEEKRDYVSTIVETIRGRVPYFCGTTALNTREVIRQTREFMDMGASG
TMLGVPMWVKMDLPTAVQFYRDVAEAVPEAAIAIYANPEAFKFDFPRPFWAEMSKIPQVV
TAKYLGIGMLDLDLKLAPNIRFLPHEDDYYAAARINPERMTAFWSSGSMCGPATAIMLRD
AVDQAKSSGDWIKAKAISDDMRAADSTLFPRGDFSEFSKYNIGLEKARMDAAGWLTAGPC
RPPYNIVPEDYIAGALKSGKAWAALHAKYSKELK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtcgaataaaactatgaaaccagcgcgtcttactgccgaggatatccatggtgtctgg
gctattatgccaacgccggctactccggatgcttctaactggcgcagcactaacacagtt
gacttaaacgagactgctcgcatagttgaagagctgattgcggctggtgtcaacggaatt
ttaagtatgggcacttttggcgagtgcgctacgttgacctgggaggaaaaacgtgactat
gtttcgacgattgtcgaaaccattcgtggtcgcgtgccttatttctgcggcaccacggcc
ttgaatacccgcgaagtcatccgccaaactcgtgagtttatggatatgggcgccagcggt
accatgctcggtgtcccaatgtgggtgaagatggacctgcccacagcggtccagttctat
cgtgatgttgcagaggcggtaccggaggctgccattgcgatttacgctaaccctgaagcc
ttcaagttcgacttccctcgccccttctgggcagaaatgtccaaaattccgcaggtagta
actgccaaatatctaggcatcggaatgcttgacttggacctgaaattggcacccaacatc
cgcttccttccacacgaggatgactattacgcggccgcacgcatcaatcctgagcgcatg
accgcgttctggtcaagcggctccatgtgcggcccggctaccgccatcatgttgcgtgat
gcagtggatcaggccaagagcagcggtgactggatcaaggccaaagccatctccgatgac
atgcgcgcagccgattcgacattgtttccgcgtggcgacttttcggagttctcgaaatac
aacatcggacttgaaaaagcacgcatggatgcagctggctggctcacagctggaccatgc
cgtccgccctataacatcgtcccagaagactatattgctggcgcccttaagtcaggcaaa
gcttgggccgcactgcatgctaaatacagcaaggaattgaagtag

DBGET integrated database retrieval system