KEGG   Pseudomonas stutzeri 19SMN4: UIB01_22655
Entry
UIB01_22655       CDS       T03366                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
pstu  Pseudomonas stutzeri 19SMN4
Pathway
pstu00626  Naphthalene degradation
pstu01100  Metabolic pathways
pstu01120  Microbial metabolism in diverse environments
pstu01220  Degradation of aromatic compounds
Module
pstu_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:pstu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    UIB01_22655
Enzymes [BR:pstu01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     UIB01_22655
SSDB
Motif
Pfam: DSBA Thioredoxin_5 PyrBI_leader
Other DBs
NCBI-ProteinID: AHY45200
UniProt: A0A023WZL4
Position
pLIB119:59344..60012
AA seq 222 aa
MIVDFYFDFLSPFSYLANHRLSKLAHDYSFSIRYHSIDLARAKIAIGNVGPSNRDLKVKL
AYLMVDLKRWAELYGLPFLFPANYNSQRMNAGLYYSGAETQTAAYVNTVFNAVWGEGIAL
DSESLLALVCGTLGWDRAAFEEFLSSDAATNAYDEHTQAAIERKVFGVPTMFLGDQMWWG
NDRLFMLENTLRCGCSAGIAAAGETGVKPVTEGDGNQSGNSP
NT seq 669 nt   +upstreamnt  +downstreamnt
gtgattgttgatttctatttcgactttttgagccctttttcttacttggctaaccatcgc
ttgtcgaagctagcccacgattatagcttttccattcgctatcactcgattgatttggcg
cgagccaaaatcgccatcggaaacgtaggcccctccaatcgcgatctgaaagtcaaactt
gcctatttgatggtggatttaaaacgctgggccgagctgtacggattaccgtttttattt
cctgccaattacaatagccaacggatgaatgctgggctctattactcgggtgccgaaacg
cagactgctgcttacgtgaatacagtattcaatgcagtttggggggaaggtatagctctg
gactcggaaagcctgcttgccctagtgtgcgggactctagggtgggatcgcgctgctttc
gaggagtttctcagcagcgacgctgcaacaaatgcgtatgatgagcatacccaggccgcc
atcgaacgtaaagtattcggtgtaccaacgatgtttttgggcgatcaaatgtggtggggc
aacgaccgtctatttatgctcgagaacacactgaggtgcggctgtagtgctggaatagcc
gccgcgggggaaaccggagtaaaaccggtaacagaaggagatggaaatcaaagcggcaat
agtccgtaa

DBGET integrated database retrieval system