KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1197Help
Entry
PSTAB_1197        CDS       T01571                                 

Definition
(GenBank) hypothetical protein
Organism
psz  Pseudomonas stutzeri ATCC 17588
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEJ04478
UniProt: F8H1Y7
Position
1255206..1255775
Genome map
AA seq 189 aa AA seqDB search
MQPSIRAVHRLALAAGLLAGSLLAAGCATTAASSAAAVPAASPTAVAPEPGFVPVARYGR
YTLVELVPEPAQRDLLQQAVEVSIPPMLDASVGDAMRHVLLRSGYRLCDAVEAATLYALP
LPAAHLRLGPLMLRDALLTLAGPAWELSVDDLTRQVCFSRHGAPTFLSANPPGTATPVPD
ADRPEELQP
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccatccatccgcgctgttcaccgcctggccctcgccgctggcttgctggccggc
agcctgttggccgccggctgcgccacgaccgccgcgtcgtctgcggcagcggtgccggcc
gcatcgccaaccgccgtcgcgccggagccgggtttcgttccggtggcccgctacggccgc
tacaccctggtcgagctggtgccggaacctgcgcagcgtgatctcttgcagcaggcggtg
gaggtctcgattccgcccatgctcgatgccagcgtgggcgatgccatgcgccatgtgctc
ctgcgctcgggctaccggctctgcgatgcggtcgaagccgccacgctctacgcgctgccg
ctgcctgccgcacacctgcgcctgggcccgctgatgctgcgcgatgccttgctgaccctt
gccggccccgcctgggagctgtcggtcgatgacttgacccgccaggtctgcttcagccgg
cacggtgctcccaccttcctttccgccaacccgcccggcaccgccacgcccgtgccggac
gccgaccggcccgaggagctgcagccatga

DBGET integrated database retrieval system