KEGG   Pseudomonas stutzeri ATCC 17588: PSTAB_1218Help
Entry
PSTAB_1218        CDS       T01571                                 

Definition
(GenBank) hypothetical protein
Organism
psz  Pseudomonas stutzeri ATCC 17588
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEJ04499
UniProt: F8H208
Position
1279657..1280061
Genome map
AA seq 134 aa AA seqDB search
MLLAATLLGGCATSKEKLLPHGDSTMLDIWHRETGGSAGGGQAARQLLDARQGLRRPLAE
ADVQAAPGVQARYTRTAQNEIYRQFHRLPNPDLVMYVFPHLAGTDPVPVPGYSTVFPLYQ
RVQYAMPGERVEDY
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
gtgctgctggcggccaccctgctcggcggctgcgctaccagcaaggagaagctgctgccg
cacggcgacagcaccatgctcgacatctggcatcgggagaccggcggcagcgcgggcggc
ggccaggccgcgcggcaactgctcgatgcgcgccagggcctgcgccggccgctggccgag
gccgatgtgcaggcggcgcccggcgtgcaggcgcgctacacccgcaccgcgcagaacgag
atttaccgccagttccaccgcctgccgaaccccgacctggtgatgtacgtgttcccgcac
ctggcgggcaccgacccggttccggtgcccggctacagcacggtgttcccgctctaccag
cgcgtgcagtacgcgatgccgggcgagcgcgtggaggactactga

DBGET integrated database retrieval system