KEGG   Stutzerimonas stutzeri ATCC 17588 = LMG 11199: PSTAB_2473
Entry
PSTAB_2473        CDS       T01571                                 
Name
(GenBank) Putative uncharacterized protein ORF SG72
Organism
psz  Stutzerimonas stutzeri ATCC 17588 = LMG 11199
SSDB
Motif
Pfam: Knl1_RWD_C Exonuc_VII_L EAD9
Other DBs
NCBI-ProteinID: AEJ05754
UniProt: F8H282
Position
2669327..2670559
AA seq 410 aa
MFADLALRNVDGHAWTFESRAMHAINSYRSCLLLAALAAGCTTPPAPSPVPDEVATPSQD
VPFTRYGRYNLVELTPTVAQQDLLLQVVDVSIPDTLNANVADALRHVLQRSGYQLCNGRE
TDTLGSLPLPAAHYHLGPLQLRNALLALAGPARTLHVDHSARRVCFIQPFNKPADAPPAT
ADTEPDVVGGVAAMTTMPGRGQHRLGTLLRAATITWLLLISAAVVIDHVALSGLAAQVET
STPSLQVDVLEERLAERVQQIEQAQQQPDALPQARYEAERQALEQRLDAIEQALGSRPTA
DNLLPLQARIEQLEMRLTAPRPTPPATTRPRVSAPAKPKIIEPPFRVIGVELRAGEQFLS
ILPSISDALSQVRLLRPGEAEAGWHLETIEANTAVFRYGEDTRRLPVPVQ
NT seq 1233 nt   +upstreamnt  +downstreamnt
ttgtttgctgatctcgctctgcgaaatgtcgatggtcacgcctggaccttcgagagccga
gccatgcatgccatcaattcctaccgcagctgcctgctgctggccgcactggcggccggc
tgtacaacgcctccagcgccctctcccgttcctgatgaagtagcaactccgtcacaggac
gtccctttcacccgctacggtcgctacaaccttgtcgagctgaccccgacggtcgcccag
caggatctgctgttgcaggtcgtcgacgtatccattcccgacacccttaacgccaatgtc
gccgacgcgctgcgccatgtgttgcagcgttccggctaccaactctgcaacggacgtgaa
accgacacgctgggcagcctcccgttgccggctgcgcactatcaccttggcccgctgcag
ctgcgcaatgccctactggccttggccgggccggcgcggacgctgcacgtcgaccacagc
gcccgtcgcgtctgcttcatccagcccttcaacaagccagccgacgcgccgcccgccact
gcggatacagagcccgatgtcgtcgggggagtcgcagccatgacaacgatgccaggcaga
gggcaacaccggctcggcacgctgctgcgcgcagctactatcacctggctgctgctcatc
agcgctgccgttgtgatcgatcatgtcgcgctgtcggggctagcggcacaggtcgaaacc
agcacacccagcctgcaagtcgacgtgctggaagaacgcctggcagaacgggtccagcag
atcgaacaagcccagcagcaaccggacgcactacctcaagcgcgctacgaagcagagcgc
caagcgctggagcagcgactggacgccatcgaacaggcgctcggcagccgcccgacagcg
gacaacctgctgccgctgcaagcccgcatcgagcagctggaaatgcggctcaccgcacct
cgcccgacaccaccagccacaacccgcccgcgagtttccgcacccgccaaaccgaagatc
atcgagccgccattccgagtgatcggggtcgagctgcgcgccggtgagcagttcctctcg
attctgccatccatctcggacgcgctctcgcaggttcgcctgctgcgccccggcgaggcc
gaagccggctggcatctcgaaaccatcgaagcgaacaccgccgtgttccgctacggcgaa
gacacccgtcgcctgcctgttcccgtgcagtag

DBGET integrated database retrieval system