KEGG   Pan troglodytes (chimpanzee): 450628
Entry
450628            CDS       T01005                                 
Symbol
SORBS1
Name
(RefSeq) sorbin and SH3 domain-containing protein 1 isoform X1
  KO
K06086  sorbin and SH3 domain containing protein 1
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr03320  PPAR signaling pathway
ptr04520  Adherens junction
ptr04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    450628 (SORBS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    450628 (SORBS1)
   03320 PPAR signaling pathway
    450628 (SORBS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ptr04990]
    450628 (SORBS1)
Domain-containing proteins not elsewhere classified [BR:ptr04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   450628 (SORBS1)
SSDB
Motif
Pfam: SH3_9 SH3_1 SH3_2 Sorb
Other DBs
NCBI-GeneID: 450628
NCBI-ProteinID: XP_016774391
Ensembl: ENSPTRG00000002784
VGNC: 12506
Position
10:complement(91157753..91407359)
AA seq 2088 aa
MSSECDGGSKAVVNGLAPGSNGQDKATANPLRARSISAVKIIPVKTVKNASGLVLPTDMD
PTKICTGKGAVTLRASSSYRETPSSSPASPQETRQHESKPGLEPEPSSADEWRLSSSADA
NGNAQPSSLAAKGYRSVHPNLPSDKSQVLSPPRPPLPQKDRFAWQSPTIHNTYKDSLYLS
SPKPYVPLGTPSQQNPSQPQPISVLLAAGSAPKGVVRPGSLLPDSTFPSASSQPQQRYAA
TRTVYHKNVSSNPCHEAVGIKKVSSLYVPCLSNNICLAASENSSRVARDPAEGTPSEAAG
TRAPAPGLVSRTAGTGKPPPAPPPDPPKLFFDIRKDAVNRGESPSLGTQASFPDVRPPVL
GPRVTSDPENRKSKESYLLQPSYPAKDATSSSAAQPEVIVVPLYLVNTDRGQEGTARPPT
PLGPLGCVPTIPATASAASPLTFPTLDDFIPPHLQRWPHHSQPARASGSFAPISQTPPSF
SPPPPLVPPAPEDLRRVSEPDLTGAVSSTDSSPLLNEVSSSLIGTDSQAFPPVSKPSSAY
PSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQDSAPTQEKPTSPGKAAEKRAKD
DSRRAVKSTQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYKF
PELPEIQQTSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSKS
EMSYIDGEKVVKRSATLPLPARSSSLKSSSERNDWEPPDKKVDTRKYRAEPKSIYEYQPG
KSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDRK
TNLDKDLSLCQTELEADLEKMETLNKAPSANVPQSSAISPTPEISSETPGYIYSSNFHAV
KRESDGAPGDLTSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKVDRKGGNAHMIS
SSSVHSRTFNTSNALGPVCKHKKPLSAAKACISEILPSKFKPRLSAPSALLQEQKSILLP
SEKAQSCENLCVSGSLNDSKRGLPLQVGGSIENLLMRSRRDYDSKSSSTMSLQEYSTSGR
RPCPLSRKAGMQFTMLYRDMHQINRSGLFLGSISSSSSVRDLASHFEKSSLALSRGELGP
SQEGSEHIPKHTVSSRITAFEQLIQRSRSMPSLDLSGRLSKSPTPVLSRGSLTSARSAES
LLESTKLRPKEMDGMNSSGVYASPTCSNMAHHALSFRGLVPSEPLSTCSDDVDRCSNIST
DSREGSGGSVHGDFPKHRLNKCKGTCPASYTRFTTIRKHEQQQTSRQPEWRLDARGDKST
LLRNIYLMSPLPFRLKKPLHHHPRQPSPGDSSGLLVGQKPDLPSQPHQDQPPSGGKPVVP
TRLSSRHTMARLSCSSEPSQERLTALEDYPRAINNGNSVPYSDHSLDRNNNPQSELAPSR
GDSESPRHFIPADYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTH
HQFITNERFGDLLNIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQ
NWYEGEHHGRVGIFPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSF
RKGERITLLRQVDENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYMDLPFSSSPSR
SATASPQFSSHSKLITPAPSSLPHSRRALSPEMHAVTSEWISLTVGVPGRRSLALTPPLP
PLPEASIYNTDHLALSPRASPSLSLSLPHLSWSDRPSPRSVASPLALPSPHKTYSLAPTS
QASLHMNGDGGVHTPSSGIHQDSFLQLPLGSSDSVISQLSDAFSSQSKRQPWREESGQYE
RKAERGAGERGPGGPKISKKSCLKPSDVVRCLSTEQRLSDLNTPEESRPGKPLGSAFPGS
EAEQTERHRGGEQAGRKAARRGGSQLSHHSLRAGPDLTESEKSYVEAVCNEIINIAEKSV
HYCSTVSHPLDFHHKVTPSDNKSSLIISQQPQAQQRRVTPDRSQTSQDLFSYQALYSYIP
QNDDELELRDGDIVDVMEKCDDGWFVGTSRRTRQFGTFPGNYVKPLYL
NT seq 6267 nt   +upstreamnt  +downstreamnt
atgagttctgaatgtgatggtggttccaaagctgtggtgaatggcttggcacctggcagc
aatgggcaagacaaagcaactgccaaccctttacgcgcacgctctatttctgctgttaaa
atcattcctgtgaagacagtgaaaaacgcctcaggcctagttctccctacagacatggat
cctacaaaaatctgcactgggaagggagcggtgactctccgggcctcgtcttcctacagg
gaaaccccaagcagtagccctgcgagccctcaggaaacccggcaacacgaaagcaaacca
ggtctggagccagagccttcttcagcagatgagtggaggctttcttccagtgctgatgcc
aatggaaatgcccagccctcttcactcgctgccaagggctacagaagtgtgcatcccaac
cttccttctgacaagtcccaggttctctctcccccacgccctcctctccctcaaaaggac
cgctttgcatggcagtcccccaccatccacaatacctataaggattccctctacctgagc
tcaccaaagccttatgtcccactcggcacccccagccagcagaacccctcacaaccccag
cccatctccgtcctcctggcagctggatcggctcccaaaggtgtggtgcgccctggttcc
ttgcttccggactccacgttccccagtgcttcatcccaaccccagcagcgctatgcagcc
accaggacagtttatcataagaatgtgagctctaacccatgtcatgaggcagttgggatt
aaaaaggtcagcagcttatatgtaccttgtttatccaataacatttgcctggcggcgtca
gaaaactcctctcgtgttgcacgtgaccctgccgaaggcactccctcggaggctgcgggc
acccgagcaccggctcccggccttgtctcccgcacagccggcacaggaaaaccaccccct
gctcctcctcctgaccctcccaagctattctttgacatccgtaaagatgccgttaaccgt
ggcgagagtccttccctggggactcaggcttcgttcccagatgtgagaccacctgtgcta
ggcccccgggttacctctgatcccgaaaaccggaagagcaaagaatcttaccttttgcag
ccgagttatccagccaaggatgccacttcctccagtgcagcccagccggaggtaatagtt
gtccctctctacctggttaatactgacagagggcaagaaggcactgccagacctccaaca
cctctggggcctcttggctgcgtccccacaatcccagcgactgcctctgccgcctcacct
ctgaccttcccgactctagatgatttcattccccctcatctgcagaggtggccccaccac
agccagccagcccgcgcctctggctcctttgcccccattagccagacgccaccatccttc
tcaccaccacctccgctggtccctcctgccccggaggacctccgcagagtctcggagcct
gacctcacgggagctgtttcgagtaccgattccagtcctctactaaatgaagtttcttct
tcccttattggaactgattcccaagcctttccaccagttagcaagccttcatccgcctat
ccctccacaacgattgtcaatcctactattgtgctcttgcaacacaatcgagaacagcaa
aaacgactcagtagcctttcagatcctgtctcagaaagaagagtgggagagcaggactca
gcaccaacccaggaaaaacccacctcacctggcaaggctgctgaaaaaagagcaaaggat
gacagtaggcgggcggtgaagagcactcaggacttaagcgatgtttccatggatgaagtg
ggcatcccactccggaacactgagagatcaaaagactggtacaagactatgtttaaacag
atccacaaactgaacagagacactcctgaagaaaacccttatttccctacgtacaaattc
cctgaacttcctgaaatccagcaaacttccgaagaggacaatccttacactcccacctac
cagtttcctgcatctactcctagtcctaaatctgaagatgatgattcagatctgtactct
cccagatactcgttttctgaagacacaaaatctcccctttctgtgcctcgctcaaaaagt
gagatgagctacattgatggtgagaaggtagtcaagaggtcggccacactacccctccca
gcccgctcttcctcactgaagtcaagctcagaaagaaatgactgggaacccccagataag
aaagtagatacaagaaaatatcgtgcagagcccaaaagcatttacgaatatcagccgggc
aagtcttccgttctgaccaacgaaaagatgagtcgggatataagcccagaagagatagat
ttaaagaatgaaccttggtataaattcttttcggaattggagtttgggaaaccgcctccc
aaaaagatatgggattatactcctggagactgctctatccttcctagagaggatagaaag
actaatctagacaaagatctcagcctctgccagacagagttagaggcagatttagaaaaa
atggagacgcttaataaagcacccagtgcaaacgtgccacagagctcagccatcagccct
actccggaaatttcttcagagactcctggatatatatattcttccaacttccatgcagtg
aagagggaatcagacggggctcctggggatctcactagcttggagaatgagagacaaatt
tataaaagtgtcttggaaggtggtgacatccctcttcagggcctgagtgggctcaagcga
ccatccagctctgcttccactaaagtggatcgtaaaggtgggaatgctcacatgatttct
tcatcttcagtccatagccgaacgtttaacactagcaatgcgttaggccctgtgtgtaag
cacaagaagcccctgtcagctgcgaaggcctgcatttcggaaatccttccttccaaattc
aaacccaggctctctgctcccagcgctcttttgcaggaacagaagagtatcctcttgccc
tcagagaaggctcaaagctgtgagaacctttgtgtttctggttctttaaatgattccaaa
agaggcctccccctccaagtgggagggagcattgagaacctgctcatgcgctcccgacgg
gattatgacagcaagtcgagcagtaccatgagcctccaggagtacagcaccagcggcagg
aggccctgtcctctctcaagaaaggctgggatgcagttcaccatgctttatcgggacatg
caccagatcaaccgatctggcctcttcctgggctccatctcctcctcctcgagtgtgcgg
gatcttgcctcccactttgaaaagagtagcctggcattgtccaggggtgagctgggcccc
agccaggagggctcggaacacatccccaagcacaccgtctcttcccgcatcaccgctttt
gagcagctgattcagcggtcccgttccatgccatccctggacctgtccggaaggctgagc
aagtctcccacacctgtgctgtcccggggcagcctgacctcagcccgctcggccgagtcc
ctacttgagtcaaccaagctccgtcccaaggagatggatgggatgaactccagtggggtc
tatgcttccccaacatgtagcaatatggcacaccatgccttgagcttcaggggccttgtg
ccttctgagcctctctccacctgctctgatgacgtggaccgctgttcaaatatctccact
gacagcagagaaggcagtggcggcagtgttcatggagatttccccaaacatcgcctcaac
aagtgcaagggcacctgcccggcctcatacacccgcttcaccaccatccggaagcatgag
cagcagcagacctctagacagcctgagtggcgcctggatgccagaggggacaagagcacc
ctcctcaggaacatctacctaatgagcccccttcctttccggctgaaaaagcccctccac
caccaccccagacaaccttcccctggtgactcctcaggcctcctggtgggccagaagcca
gacctccccagtcagccccatcaggaccagcccccttctggggggaagcccgtggttccc
acacgcctgtcttcccgacacaccatggccaggcttagctgcagctcagagccctctcag
gagagactcacggccctggaggactacccaagggccattaataatggaaactccgtgcca
tactcagaccacagcctggacaggaacaacaacccacaaagtgaactggcaccatcccgt
ggagattcagaatcgccaagacattttataccagctgattacttggaatccacggaagaa
tttattcgaagacgtcatgatgataaagagaaacttttagcggaccagagacgacttaag
cgcgagcaagaagaggctgatattgcagctcgacgccacacaggcgtcattccgacgcac
catcagtttatcactaatgagcgctttggggacctcctcaatatagacgatactgcaaaa
aggaaatctgggtcagagatgagacctgccagagccaaatttgactttaaagctcagaca
ctaaaggagcttcctctgcagaagggagatattgtttacatttataagcaaattgatcag
aactggtatgaaggagaacaccacggccgggtgggaatcttcccacgcacctacatcgag
ctccttcctcctgctgagaaggcacagcccaaaaagttgacaccagtgcaggttttggaa
tatggagaagctattgctaagtttaactttaatggtgatacacaagtagaaatgtccttc
agaaagggtgagaggatcacactgctccggcaggtagatgagaactggtacgaagggagg
atcccggggacatcccgacaaggcatcttccccatcacctacgtggatgtgatcaagcga
ccactggtgaaaaaccctgtggattacatggacctgcctttctcctcctccccaagtcgc
agtgccactgcaagcccacagttttccagtcacagcaagctcatcacgccagccccctca
tctctgccccactcccgccgagccctgtcccccgagatgcacgctgtcacctctgagtgg
atctcactgacggtgggggtcccaggcaggcgttctctggccctgaccccacccttgcct
cctctgccagaggcttctatctataacactgaccacctcgccttgtcaccgagggccagt
ccctccctgtctctcagcctcccccatttgagttggtcagatcgtccctccccacgatca
gtagcttctccactggccctaccttccccacacaaaacctactccctagcacccacttcc
caggcctcccttcacatgaatggagacggtggtgtccacacgccatcttcaggcatccac
caagatagcttcttgcagctgccgttggggagctctgatagtgtcatctcccagcttagt
gatgcctttagcagccagagcaagaggcagccatggcgcgaagagagtggacaatatgag
aggaaagcagagaggggggcaggcgaaagaggccctggtggacccaagatctctaagaag
agctgcttgaagccttcagacgtggtcaggtgcctgagtactgaacagagactctcagat
ctcaacacccctgaggagagccggcccggcaagcccctgggtagcgcttttccaggaagt
gaggctgagcagacagagcggcatagaggtggcgagcaggcggggaggaaagctgctcgg
agaggtgggagccagctttctcatcattcattgagagcaggaccagatctcacagaatct
gaaaagagctatgtggaagcggtttgcaatgagatcataaacattgccgaaaaatctgtt
cattactgcagcactgtttctcatccccttgactttcatcacaaggtaaccccttctgac
aataaatcatctttaatcatttctcagcaacctcaagcccagcagcgaagagtcaccccc
gacaggagtcaaacctcacaagatttatttagctatcaagcattatatagctatatacca
cagaatgatgatgagctggaactccgcgatggagatatcgttgatgtcatggaaaaatgt
gacgatggatggtttgttggtacttcaagaaggacaaggcagtttggtacttttccaggc
aactatgtaaaacctttgtatctataa

DBGET integrated database retrieval system