KEGG   Pan troglodytes (chimpanzee): 452849
Entry
452849            CDS       T01005                                 

Gene name
NPAS3
Definition
(RefSeq) LOW QUALITY PROTEIN: neuronal PAS domain-containing protein 3
  KO
K09098  neuronal PAS domain-containing protein 1/3
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    452849 (NPAS3)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    452849 (NPAS3)
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 PAS_9 HLH
Other DBs
NCBI-GeneID: 452849
NCBI-ProteinID: XP_009425908
Ensembl: ENSPTRG00000006249
VGNC: 3344
Position
14
AA seq 984 aa
MIRIFPDFSVQVTAAAAGGAAAGVPAGAGMGRAGAAANGTPQNVQGITSYQQRITAQHPL
PNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAARSRRGKENFEFYELAKLLPLPAAI
TSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEGPPPNTSVKGIQMWKSELCMRKTPC
EVIGAQRRRSPSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYISETVSIYLGLSQV
ELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSETPEPVES
TSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSHGRTVPSQ
IMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVDIVGKRCY
HFIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKNANEKNII
WVNYLLSNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNENSKSDEKG
NQSENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENPKAGEDGF
GALGPMQIKVERYVESESDLRLQNCESLTSDSAKDSDSAGEAGAQASSKHQKRKKRRKRQ
KGGSASRRRLSSASSPGGLDAGLVEPPRLLSSPNSASVLKIKTEISEPINFDNDSSIWNY
PPNREISRNESPYSMTKPPSSEHFPSPQGGGGGGGGGGGGLHVAIPDSVLTPPGADGAAA
RKTQFGASATAALAPVASDPLSPPLSASPRDKHPGNGGXGGGGAGGGGPSGSNSLLYTGD
LEALQRLQAGNVVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQSNLLPNAH
AVNFVDVNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPAGNVFTTAEGL
FSTLPFPVYSNGIHAAQTLERKED
NT seq 2955 nt   +upstreamnt  +downstreamnt
atgatccgaatctttccggatttcagcgtgcaggtgacggccgcggcggccggcggggcg
gccgcgggggtgccggccggcgcgggcatggggagggccggcgccgcggccaacggcacc
ccgcagaacgtccagggcatcacctcctaccagcagcgaataactgcccagcatcctctg
cccaaccaatcagaatgtaggaaaatctacagatatgacggaatctactgtgaatctacc
taccagaatttacaagcattgagaaaggagaaatcccgagatgctgctcgctcccgccgg
ggaaaagaaaactttgagttctatgaattggccaagttgttgcctcttcctgcagccatt
accagccagctcgacaaggcatccatcattcgacttacaattagctatctgaaaatgagg
gactttgctaaccagggggaccctccgtggaacttgcgaatggaaggccctccacctaac
acatcagtaaaagggatacaaatgtggaaatctgaactctgcatgagaaagacaccatgt
gaagttataggtgcacagcgaaggagaagccccagtgcactagccattgaagtatttgaa
gcacatttgggaagccacattttgcagtccctggatggctttgtatttgcactaaatcaa
gaaggaaaatttttgtacatttccgaaacagtctccatctacctaggcctctcacaagtg
gagctgacaggcagcagtgtctttgactatgtccaccccggagatcacgtggagatggct
gagcagctgggcatgaagctcccccctgggcggggtctcctgtcacagggcactgctgag
gacggagccagctcagcatcttcctcctctcagtcggagacccccgagccagtggagtca
accagccccagtctgctaaccactgacaacactcttgagcgttcctttttcatccgaatg
aaatctactctgaccaaacgcggtgtgcacatcaaatcatcaggatataaggtgattcac
ataacaggccggctacgcctgagagtgtcgctgtcccacgggaggaccgtccccagccaa
atcatgggtctcgtggttgttgcgcatgccttgcctccccctacgatcaatgaagtcaga
attgactgccatatgttcgtcactcgagtaaatatggacctcaatatcatttactgtgaa
aataggattagtgattatatggatctgacccctgtagatatcgtagggaagagatgctac
cacttcatccatgctgaagacgtggagggcatcaggcacagtcacttggacttgctgaat
aagggtcagtgtgtgacaaagtactatcgctggatgcagaagaacggaggatatatttgg
atacagtccagtgccaccatagctattaatgccaagaacgcaaatgaaaagaatatcatc
tgggtgaattaccttcttagcaatcctgagtacaaggacacacccatggacatcgcacag
ctcccccatctgccggagaaaacttccgagtcctcggagacatccgactctgagtcagac
tctaaagacacctcaggtattacagaggacaacgagaactccaagtccgacgagaagggg
aaccagtccgagaacagcgaagacccggagcccgaccggaagaagtcgggcaacgcgtgt
gacaacgacatgaactgcaacgacgacggccacagctccagtaacccggacagccgcgac
agcgacgacagcttcgagcactcggactttgagaaccccaaggcgggcgaggacggcttc
ggtgctctgggcccgatgcagatcaaggtggagcgctacgtggagagcgagtcggacctg
cggctgcagaactgcgagtcactcacgtccgacagcgccaaggactcggacagcgcaggc
gaggcgggcgcgcaggcctccagcaagcaccagaagcgcaagaaaaggcggaaacggcaa
aagggcggcagcgccagccgccggcgcctgtccagcgcgtcgagcccaggcggcctggac
gcgggcctggtggagcccccgcggctgctgtcctcccccaacagtgcctcggtgctcaag
atcaagacggagatctcggaacccatcaatttcgacaatgacagcagcatctggaactac
ccgcctaaccgggagatctccaggaacgagtccccctacagcatgaccaagccccccagc
tctgagcacttcccgtccccgcagggcggcggcggcggtgggggtggcggtggcgggggg
ctgcacgtggccattcccgactcggtcctcaccccgcccggcgccgacggcgcggccgcc
cgcaagactcagttcggcgcctcggccaccgcggccctggcccccgtcgcctccgacccg
ctgtcacccccgctctcggcgtccccgcgggacaagcaccccgggaacggcggcnngggg
ggcggcggcgcggggggcggcggccccagcgggtccaactccttgctgtacactggggac
ctggaggcgctgcagaggttgcaggcgggcaacgtcgtgctcccgctggtgcacagggtg
accgggaccctggccgccaccagcacggccgcgcagagggtctacaccacgggcaccatc
cgctacgcgcccgccgaggtgaccctggccatgcagagcaacctgctgcccaacgcgcac
gctgttaacttcgtggacgttaacagccccggctttggcctcgaccccaagacgcccatg
gagatgctctaccaccacgtgcaccggctcaacatgtcaggaccgttcggcggcgcagtg
agcgcagctagcctgacgcagatgcccgccggcaacgtgttcaccacggccgagggactc
ttctccacgctgcccttccccgtctacagcaacggcatccacgcggcacagactctggag
cgcaaggaggactga

DBGET integrated database retrieval system