KEGG   Pan troglodytes (chimpanzee): 454169
Entry
454169            CDS       T01005                                 
Symbol
CTCF
Name
(RefSeq) transcriptional repressor CTCF isoform X2
  KO
K23195  transcriptional repressor CTCF
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    454169 (CTCF)
   03036 Chromosome and associated proteins [BR:ptr03036]
    454169 (CTCF)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    454169 (CTCF)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    454169 (CTCF)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz zf-met zf-C2HE zf-C2H2_6 zf-WIZ
Other DBs
NCBI-GeneID: 454169
NCBI-ProteinID: XP_054525406
Ensembl: ENSPTRG00000008235
VGNC: 9044
Position
18:65606469..65683367
AA seq 725 aa
MEGDAVEAIVEESETFIKGKERKTYQRRREGGQEEDACHLPQNQTDGGEVVQDVNSSVQM
VMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPV
PVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQ
GELPPQEDPSWQKDPDYQPPAKKTKKTKKSKLRYTEEGKDVDVSVYDFEEEQQEGLLSEV
NAEKVVGNMKPPKPTKIKKKGVKKTFQCELCSYTCPRRSNLDRHMKSHTDERPHKCHLCG
RAFRTVTLLRNHLNTHTGTRPHKCPDCDMAFVTSGELVRHRRYKHTHEKPFKCSMCDYAS
VEVSKLKRHIRSHTGERPFQCSLCSYASRDTYKLKRHMRTHSGEKPYECYICHARFTQSG
TMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYIEQGKKCRYCDAVFHERY
ALIQHQKSHKNEKRFKCDQCDYACRQERHMIMHKRTHTGEKPYACSHCDKTFRQKQLLDM
HFKRYHDPNFVPAAFVCSKCGKTFTRRNTMARHADNCAGPDGVEGENGGETKKSKRGRKR
KMRSKKEDSSDSENAEPDLDDNEDEEEPAVEIEPEPEPQPVTPAPPPAKKRRGRPPGRTN
QPKQNQPIIQVEDQNTGAIENIIVEVKKEPDAEPAEGEEEEAQPAATDAPNGDLTPEMIL
SMMDR
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggaaggtgatgcagtcgaagccattgtggaggagtccgaaacttttattaaaggaaag
gagagaaagacttaccagagacgccgggaagggggccaggaagaagatgcctgccactta
ccccagaaccagacggatgggggtgaggtggtccaggatgtcaacagcagtgtacagatg
gtgatgatggaacagctggaccccacccttcttcagatgaagactgaagtaatggagggc
acagtggctccagaagcagaggctgctgtggacgatacccagattataactttacaggtt
gtaaatatggaggaacagcccataaacataggagaacttcagcttgttcaagtacctgtt
cctgtgactgtacctgttgctaccacttcagtagaagaacttcagggggcttatgaaaat
gaagtgtctaaagagggccttgcggaaagtgaacccatgatatgccacaccctacctttg
cctgaagggtttcaggtggttaaagtgggggccaatggagaggtggagacactagaacaa
ggggaacttccaccccaggaagatcctagttggcaaaaagacccagactatcagccacca
gccaaaaaaacaaagaaaaccaaaaagagcaaactgcgttatacagaggagggcaaagat
gtagatgtgtctgtctacgattttgaggaagaacagcaggagggtctgctatcagaggtt
aatgcagagaaagtggttggtaatatgaagcctccaaagccaacaaaaattaaaaagaaa
ggtgtaaagaagacattccagtgtgagctttgcagttacacgtgtccacggcgttcaaat
ttggatcgtcacatgaaaagccacactgatgagagaccacacaagtgccatctctgtggc
agggcattcagaacagtcaccctcctgaggaatcaccttaacacacacacaggtactcgt
cctcacaagtgcccagactgcgacatggcctttgtgaccagtggagaattggttcggcat
cgtcgttacaaacacacccacgagaagccattcaagtgttccatgtgcgattacgccagt
gtagaagtcagcaaattaaaacgtcacattcgctctcatactggagagcgtccgtttcag
tgcagtttgtgcagttatgccagcagggacacatacaagctgaaaaggcacatgagaacc
cattcaggggaaaagccttatgaatgttatatttgtcatgctcggtttacccaaagtggt
accatgaagatgcacattttacagaagcacacagaaaatgtggccaaatttcactgtccc
cactgtgacacagtcatagcccgaaaaagtgatttgggtgtccacttgcgaaagcagcat
tcctatattgagcaaggcaagaaatgccgttactgtgatgctgtgtttcatgagcgctat
gccctcatccagcatcagaagtcacacaagaatgagaagcgctttaagtgtgaccagtgt
gattacgcttgtagacaggagaggcacatgatcatgcacaagcgcactcacaccggggag
aagccttacgcctgcagccactgcgataagaccttccgccagaagcagcttctcgacatg
cacttcaagcgctatcacgaccccaacttcgtccctgcggcctttgtctgttctaagtgt
gggaaaacatttacacgtcggaataccatggcaagacatgctgataattgtgctggccca
gatggcgtagagggggaaaatggaggagaaacgaagaagagtaaacgtggaagaaaaaga
aagatgcgctctaagaaagaagattcctctgacagtgaaaatgctgaaccagatctggac
gacaatgaggatgaggaggagcctgccgtagaaattgaacctgagccagagcctcagcct
gtgaccccagccccaccacccgccaagaagcggagaggacgaccccctggcagaaccaac
cagcccaaacagaaccagcctatcattcaggttgaagaccagaatacaggtgcaattgag
aacattatagttgaagtaaaaaaagagccagatgctgagcccgcagagggagaggaagag
gaggcccagccagctgccacagatgcccccaacggagacctcacgcccgagatgatcctc
agcatgatggaccggtga

DBGET integrated database retrieval system