KEGG   Pan troglodytes (chimpanzee): 455649Help
Entry
455649            CDS       T01005                                 

Gene name
INSR
Definition
(RefSeq) insulin receptor isoform X1
  KO
K04527  insulin receptor [EC:2.7.10.1]
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04010  MAPK signaling pathway
ptr04014  Ras signaling pathway
ptr04015  Rap1 signaling pathway
ptr04022  cGMP-PKG signaling pathway
ptr04066  HIF-1 signaling pathway
ptr04068  FoxO signaling pathway
ptr04072  Phospholipase D signaling pathway
ptr04150  mTOR signaling pathway
ptr04151  PI3K-Akt signaling pathway
ptr04152  AMPK signaling pathway
ptr04211  Longevity regulating pathway
ptr04213  Longevity regulating pathway - multiple species
ptr04520  Adherens junction
ptr04910  Insulin signaling pathway
ptr04913  Ovarian steroidogenesis
ptr04923  Regulation of lipolysis in adipocytes
ptr04930  Type II diabetes mellitus
ptr04931  Insulin resistance
ptr04932  Non-alcoholic fatty liver disease (NAFLD)
ptr04960  Aldosterone-regulated sodium reabsorption
Module
ptr_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    455649 (INSR)
   04015 Rap1 signaling pathway
    455649 (INSR)
   04010 MAPK signaling pathway
    455649 (INSR)
   04066 HIF-1 signaling pathway
    455649 (INSR)
   04068 FoxO signaling pathway
    455649 (INSR)
   04072 Phospholipase D signaling pathway
    455649 (INSR)
   04022 cGMP - PKG signaling pathway
    455649 (INSR)
   04151 PI3K-Akt signaling pathway
    455649 (INSR)
   04152 AMPK signaling pathway
    455649 (INSR)
   04150 mTOR signaling pathway
    455649 (INSR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    455649 (INSR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    455649 (INSR)
   04923 Regulation of lipolysis in adipocyte
    455649 (INSR)
   04913 Ovarian Steroidogenesis
    455649 (INSR)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    455649 (INSR)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    455649 (INSR)
   04213 Longevity regulating pathway - multiple species
    455649 (INSR)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    455649 (INSR)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    455649 (INSR)
   04931 Insulin resistance
    455649 (INSR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ptr01001]
    455649 (INSR)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:ptr04090]
    455649 (INSR)
Enzymes [BR:ptr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     455649 (INSR)
Protein kinases [BR:ptr01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   455649 (INSR)
CD molecules [BR:ptr04090]
 Proteins
  455649 (INSR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2 DUF4476
Motif
Other DBs
NCBI-GeneID: 455649
NCBI-ProteinID: XP_016790339
VGNC: 11232
UniProt: K7CJP0
Position
19
AA seq 1382 aa AA seqDB search
MGTGGRRGAAAAPLLVAVAALLLGAAGHLYPGEVCPGMDIRNNLTRLHELENCSVIEGHL
QILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGSRLFFNYAL
VIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNYIVLNKDDNE
ECGDICPGTAKGKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECL
GNCSQPDDPTKCVACRNFYLDGRCVETCPPPYYHFQDWRCVNFSFCQDLHHKCKNSRRQG
CHQYVIHNNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGC
TVINGSLIINIRGGNNLAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRGETL
EIGNYSFYALDNQNLRQLWDWSKHNLTITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQE
RNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQ
NVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFS
DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWE
RQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQIL
KELEESSFRKTFEDYLHNVVFVPRKTSSGTGAEDPRPSRKRRSLGDVGNVTVAVPTVAAF
PNTSSTSVPTSPEEHRPFEKVVNKESLVISGLRHFTGYRIELQACNQDTPEERCSVAAYV
SARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEELHLCV
SRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIG
PLIFVFLFSVVIGSIYLFLRKRQPDGPLGPLYASSNPEYLSASDVFPCSVYVPDEWEVPR
EKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKG
FTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMA
AEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIYETDYYRKGGKGLLPV
RWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDN
CPERVTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENKAPESEELEME
FEDMENVPLDRSSHCQREEAGGRDGGSSLGFKRSYEEHIPYTHMNGGKKNGRILTLPRSN
PS
NT seq 4149 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgggggccggcggggggcggcggccgcgccgctgctggtggcggtggccgcg
cttctactgggcgccgcgggccacctgtaccccggagaggtgtgtcccggcatggatatc
cggaacaacctcactaggttgcatgagctggagaattgctctgtcatcgaaggacacttg
cagatactcttgatgttcaaaacgaggcccgaagatttccgagacctcagtttccccaaa
ctcataatgatcactgattacttgctgctcttccgggtctatgggctcgagagcctgaag
gacctgttccccaacctcacggtcatccgggggtcacgactgttctttaactacgcgctg
gtcatcttcgagatggttcacctcaaggaactcggcctctacaacctgatgaacatcacc
cggggttctgtccgcatcgagaagaacaatgagctctgttacttggccactatcgactgg
tcccgtatcctggattccgtggaggataattacatcgtgttgaacaaagatgacaacgag
gagtgtggagacatctgtccgggtaccgcgaagggcaagaccaactgccccgccaccgtc
atcaacgggcagtttgtcgaacgatgttggactcacagtcactgccagaaagtttgcccg
accatctgtaagtcacacggctgcaccgccgaaggcctctgttgccacagcgagtgcctg
ggcaactgttctcagcccgacgaccccaccaagtgcgtggcctgccgcaacttctacctg
gacggcaggtgtgtggagacctgcccgcccccgtactaccacttccaggactggcgctgt
gtgaacttcagcttctgccaggacctgcaccacaaatgcaagaactcgcggaggcagggc
tgccaccagtacgtcattcacaacaacaagtgcatccctgagtgtccctccgggtacacg
atgaattccagcaacttgctgtgcaccccatgcctgggtccctgtcccaaggtgtgccac
ctcctagaaggcgagaagaccatcgactcggtgacgtctgcccaggagctccgaggatgc
accgtcatcaacgggagtctgatcatcaacattcgaggaggcaacaatctggcagctgag
ctagaagccaacctcggcctcattgaagaaatttcagggtatctaaaaatccgccgatcc
tacgctctggtgtcactttccttcttccggaagttacgtctgattcgaggagagaccttg
gaaatcgggaactactccttctatgccttggacaaccagaacctaaggcagctctgggat
tggagcaaacacaacctcaccatcactcaggggaaactcttcttccactataaccccaaa
ctctgcttgtcagaaatccacaagatggaagaagtttcaggaaccaaggggcgccaggag
agaaacgacattgccctgaagaccaatggggaccaggcatcctgtgaaaatgagttactt
aaattttcttacattcggacatcttttgacaagatcttgctgagatgggagccgtactgg
ccccccgacttccgagacctcttggggttcatgctgttctacaaagaggccccttatcaa
aatgtgacggagttcgacgggcaggatgcatgtggttccaacagttggacggtggtagac
attgacccacccctgaggtccaacgaccccaaatcacagaaccacccagggtggctgatg
cggggtctgaagccctggacccagtatgccatcttcgtgaagaccctggtcaccttttcg
gatgaacgccggacctatggggccaagagtgacatcatttatgtccagacagatgccacc
aacccctccgtgcccctggatccaatctcagtgtctaactcatcatcccagattattttg
aagtggaaacccccctccgaccccaatggcaacatcacccactacctggttttctgggag
aggcaggcggaagacagtgagctgttcgaactggattattgcctcaaagggctgaagctg
ccctcgaggacctggtctccaccattcgagtctgaagattctcagaagcacaaccagagt
gagtatgaggattcggccggcgaatgctgctcctgtccaaagacagactctcagatcctg
aaggagctggaggagtcctcgtttaggaagacgtttgaggattacctgcacaacgtggtt
ttcgtccccagaaaaacctcttcaggcactggtgccgaggaccctaggccatctcggaaa
cgcaggtcccttggcgatgttgggaatgtgacggtggccgtgcccacggtggcagctttc
cccaacacttcctcgaccagcgtgcccacgagtccggaggagcacaggccttttgagaag
gtggtgaacaaggagtcgctggtcatctccggcttgcgacacttcacgggctatcgcatc
gagctgcaggcttgcaaccaggacacccctgaggaacggtgcagtgtggcagcctacgtc
agtgccaggaccatgcctgaagccaaggctgatgacattgtcggccctgtgacgcatgaa
atctttgagaacaacgttgtccacttgatgtggcaggagccgaaggagcccaatggtctg
atcgtgctgtatgaagtgagttatcggcgatatggtgatgaggagctgcatctctgcgtc
tcccgcaagcacttcgctctggagcggggctgcaggctgcgtgggctgtcaccggggaac
tacagcgtgcgagtccgggccacctcccttgcgggcaacggctcttggacggaacccacc
tatttctacgtgacagactatttagatgtcccgtcaaatattgcaaaaattatcatcggc
cccctcatctttgtctttctcttcagtgttgtgattggaagtatttatctattcctgaga
aagaggcagccagatgggccgctgggaccgctttacgcttcttcaaaccctgagtatctc
agtgccagtgatgtgtttccatgctctgtgtacgtgccggacgagtgggaggtgcctcga
gagaagatcaccctccttcgagagctggggcagggctccttcggcatggtgtatgagggc
aatgccagggacatcatcaagggtgaggcagagacccgcgtggcggtgaagacggtcaac
gagtcagccagtctccgagagcggattgagttcctcaatgaggcctcggtcatgaagggc
ttcacctgccatcatgtggtgcgcctcctgggagtggtgtccaagggccagcccacactg
gtggtgatggagctgatggctcacggagacctgaagagctacctccgttctctgcggcca
gaggctgagaataatcccggccgccctccccctacccttcaagagatgattcagatggcg
gcagagattgctgatgggatggcctacctgaacgccaagaagtttgtgcatcgggacctg
gcagcgagaaactgcatggtcgcccatgattttactgtcaaaattggagactttggaatg
accagagacatctatgaaacggattactaccggaaagggggcaagggtctgctccctgta
cggtggatggcgccagagtccctgaaggatggggtcttcaccacttcttctgacatgtgg
tcctttggcgtggtcctttgggaaatcaccagcttggcagaacagccttaccaaggcctg
tctaatgaacaggtgttgaaatttgtcatggatggagggtatctggatcaacccgacaac
tgtccagagagagtcactgacctcatgcgcatgtgctggcaattcaaccccaagatgagg
ccaaccttcctggagattgtcaacctgctcaaggacgacctgcaccccagctttccggag
gtgtcgttcttccacagcgaggagaacaaggctcccgagagcgaggagctggagatggag
tttgaggacatggagaatgtgcccctggaccgttcctcgcactgtcagagggaggaggcg
gggggccgggatggagggtcctcactaggtttcaagcggagctacgaggaacacatccct
tacacacacatgaacggaggcaagaaaaacgggcggattctgaccttgcctcggtccaat
ccttcctaa

DBGET integrated database retrieval system