KEGG   Pan troglodytes (chimpanzee): 456149
Entry
456149            CDS       T01005                                 

Gene name
HIF3A
Definition
(RefSeq) hypoxia-inducible factor 3-alpha isoform X15
  KO
K09096  hypoxia-inducible factor 3 alpha
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    456149 (HIF3A)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    456149 (HIF3A)
SSDB
Motif
Pfam: PAS_3 PAS_11 HIF-1 PAS PAS_4 PAS_9
Other DBs
NCBI-GeneID: 456149
NCBI-ProteinID: XP_001167499
Ensembl: ENSPTRG00000011180
VGNC: 7686
UniProt: A0A6D2VU47 A0A2I3RUN2
Position
19
AA seq 600 aa
MRPAAGAARRPRCCTSWLTRCPSPAASAPTWTRPLSCASPSATCACTASAPQLELIGHSI
FDFIHPCDQEELQDALTPQQTLSRRKVEAPTERCFSLRMKSTLTSRGRTLNLKAATWKVL
NCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLDM
KFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTGQYRFLAR
SGGYLWTQTQATVVSGGRGPQSESIVCVHFLISRVEETGVVLSLEQTEQHSRRPIQRGAP
SQKDTPNPADSLDAPGPRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGPILDGASVAA
TPSTPLATRRPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALDLEM
LAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALEPSLLPRWGSDPRL
SCSSPSRGDPSASSPVAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEHENFLLFPLS
LSFLLTGGPAPGSLQDPSTPLLNLNEPLGLRPSLLSPYSDEDTTQPGGPFQPRAGSAQAD
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgcggcccgcagccggcgcagccaggagaccgaggtgctgtaccagctggctcacacgc
tgcccttcgcccgcggcgtcagcgcccacctggacaaggcctctatcatgcgcctcacca
tcagctacctgcgcatgcaccgcctctgcgccgcagctggagctcatcggacacagcatc
tttgatttcatccacccctgtgaccaagaggagcttcaggacgccctgaccccccagcag
accctgtccaggaggaaggtggaggcccccacggagcggtgcttctccttgcgcatgaag
agtacgctcaccagccgcgggcgcaccctcaacctcaaggcggccacctggaaggtgctg
aactgctctggacatatgagggcctacaagccccctgcacagacttctccagctgggagc
cctgactcagagcccccactgcagtgcctggtgctcatctgtgaagccatcccccaccca
ggcagcctggagcccccgctgggccgaggggccttcctcagccgccacagcctggacatg
aagttcacctactgtgacgacaggattgcagaagtggctggctatagtcccgatgacctg
atcggctgttccgcctacgagtacatccacgcgctggactccgatgcggtcagcaagagc
atccacaccttgctgagcaagggccaggcagtaacagggcagtatcgcttcctggcccgg
agtggtggctacctgtggacccagacccaggccacagtggtgtcagggggacggggcccc
cagtcggagagtatcgtctgtgtccattttttaatcagccgggtggaagagaccggagtg
gtgctgtccctggagcaaacggagcaacactctcgcagacccattcagcggggcgccccc
tctcagaaggacacccctaaccctgcggacagccttgacgcccctggcccccggatcctt
gccttcctgcacccgccttccctgagcgaggctgccctggccgctgacccccgccgtttc
tgcagccctgacctccgtcgcctcctgggacccatcctggatggggcttcagtagcggcc
actcccagcaccccgctggccacacggcgcccccaaagtcctctttcggctgatctccca
gatgaactacctgtgggcaccgagaatgtgcacagactcttcacctccgggaaagacact
gaggcagtggagacagatttagatatagctcaggatgccgatgctctggatttggagatg
ctggccccctacatctccatggatgatgacttccagctcaacgccagcgagcagctaccc
agggcctaccacagacctctgggggctgtcccccggccccgtgctcggagcttccatggc
ctgtcacctccagcccttgagccctccctgctgccccgctgggggagtgacccccggctg
agctgctccagcccttccagaggggacccctcagcatcctctcccgtggctggggctcgg
aagaggaccctggcccagagctcagaggacgaggacgagggagtggagctgctgggagtg
agacctcccaaaaggtcccccagcccagaacacgaaaactttctgctgtttcccctcagc
ctgagtttccttctgacaggaggaccagccccagggagcctgcaggaccccagcacccca
ctcctgaacctgaatgagcccctgggcctgcgcccctcactgctctctccgtactcagac
gaggacactacccagcccgggggccccttccagccaagggcaggctcagcccaggctgac
tga

DBGET integrated database retrieval system