KEGG   Pan troglodytes (chimpanzee): 461687
Entry
461687            CDS       T01005                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor isoform X1
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    461687 (AHRR)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    461687 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_4 PAS_3 PAS_9
Other DBs
NCBI-GeneID: 461687
NCBI-ProteinID: XP_016808363
Position
5
AA seq 678 aa
MRRPAVGAEKSNPSKRHRDRLNAELDHLASLLPFPPEIISKLDKLSVLRLSVSYLRVKSF
FQVVQEQSSRQPAAGAPSPGDSCPLAGSAVLEGRLLLESLNGFALVVSAEGTIFYASATI
VDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQPPPLETGDDAILGRL
LRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLKFLFGQKRKAPSGAM
LPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADTAATTDAKVKATTSLCESELHGKP
NYSAGRSSRESGVLVLREQTDADRWAQVPARAPCLCLRGGPDLVLDPKGGSGDREEEQHR
MLSRASGVTGRRETPGPTKPLPWTVGKHSEDGARPRLQPSKNDPRSLRPMPRGSCLPYPC
VQGTFRNSPISHPPSPSPSAYSSRTSRPVREVGEDQVHPPLCHFPQGSLQHQLPQPGAQR
FATRGYPMEDVKLQGVPMPPGDLCGPTLLLDVSIKMEKDSGCEDAADGCVPSQVWLGASD
RSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQPHGRATAGRSRELTPFHPAHCACL
EPTHGLPQSEPPHQLCARGRGEQSCTCRDAEAAPVVKREPLDSPQWATHSQGVVPGMFPK
SALATLVPPQASGCTFLP
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgaggaggcccgccgtgggggcagagaagtccaacccctccaagcgacaccgggaccgc
ctcaacgccgagttggaccacctggccagcctgctgccgttcccgcctgaaatcatctcc
aagctggacaagctttctgtcctgcgcctcagtgtcagttacctccgggtgaagagcttc
ttccaagtcgtgcaggagcagagctcacggcagcctgcggccggcgccccctcgcccgga
gacagctgtcctcttgcagggtctgccgtgctggagggaaggctgctgttggagtctctt
aatggctttgctctggtcgtgagtgcagaagggacgatattttatgcgtcagcaacgatc
gtggactatctgggcttccatcagacggatgtaatgcaccagaacatttacgactacatc
cacgtggacgaccgccaggacttctgccggcagctccactgggccatggaccctccccag
gtggtgtttgggcagcccccgcccttggagacaggagatgatgctatcctggggaggctg
ctcagggcccaggagtggggcacaggcacgcccaccgagtactcggccttcctgacccgc
tgcttcatctgccgtgtgcgctgcctgctggacagcacctcgggcttcctgacgatgcag
tttcaaggaaaactaaaattcctgtttggacagaagaggaaggcgccgtcaggagccatg
ctcccgccgcggctgtcgctgttctgcattgcggcacccgttctcctcccctccgcagcg
gagatgaaaatgaggagcgcgctcctgagggcaaaacccagggcagacaccgcagccacc
acggatgcaaaagtaaaagccaccaccagtctgtgcgaatcggaactgcatggaaaaccc
aattactcagcaggaaggagcagcagagagagcggcgttttggtgctcagggaacagact
gacgctgaccgatgggcacaggttcccgccagggccccatgcctgtgcctccggggcggc
cctgaccttgtccttgaccccaaggggggctcaggggacagggaggaggagcagcacagg
atgctgagcagggcctctggagtgacagggcggagggagactccagggcccacaaagccc
ctgccctggacagtgggaaagcacagtgaggatggtgccaggccgaggctgcagcccagc
aagaatgacccgcgctccctgcgccccatgccccgcggctcctgcctgccctacccgtgt
gtccagggcactttcaggaactcgcccatctctcacccgccgagcccgtcccccagtgcc
tactccagccggaccagcagacccgtgcgggaagttggtgaggaccaggtacaccctccc
ctctgccactttccccaggggagcctgcagcaccagctccctcagcctggagctcagcgt
tttgccacgaggggctatcccatggaggacgtgaagctgcaaggtgtaccgatgcctccg
ggggacctgtgtggtccgacgctgctgctagatgtgtccatcaagatggagaaggactct
gggtgtgaggatgctgcagacggctgtgtgcccagccaggtgtggctgggggccagtgac
aggagccacccagccaccttccctaccaggatgcacctgaaaacagagccagactctcgg
caacaggtgtacatctcgcacctggggcacggcgtgcggggggctcagccccatgggagg
gccactgctgggcgcagcagggagctgacccctttccaccctgcacactgtgcctgcctg
gagcccacacacggccttccccagtcggagcctccccaccagctctgtgcacggggccga
ggtgaacagtcctgcacctgcagagatgctgaggccgcccctgtggtcaagcgggagccc
ttggactcgccccagtgggctactcacagccagggagtggtgcccgggatgtttcccaaa
agtgccttggccacgctggtcccgccccaagcttcggggtgcacattcctgccatag

DBGET integrated database retrieval system