KEGG   Pan troglodytes (chimpanzee): 468478
Entry
468478            CDS       T01005                                 

Gene name
ANKRD12
Definition
(RefSeq) ankyrin repeat domain-containing protein 12 isoform X1
  KO
K21436  ankyrin repeat domain-containing protein 11/12
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ptr03036]
    468478 (ANKRD12)
Chromosome and associated proteins [BR:ptr03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    Other HDAC associated proteins
     468478 (ANKRD12)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 468478
NCBI-ProteinID: XP_016788791
Ensembl: ENSPTRG00000009857
VGNC: 5140
UniProt: K7CPS3 A0A6D2XI08
Position
18
AA seq 2062 aa
MPKSGFTKPVQSENSDSDSNMVEKPYGRKSKDKIASYSKTPKIERSDVSKEMKEKSSMKR
KLPFTISPSRNEERDSDTDSDPGHTSENWGERLISSYRTYSEKEGPEKKKTKKEAGNKKS
TPVSILFGYPLSERKQMALLMQMTARDNSPDSTPNHPSQTTPAQKKTPSSSSRQKDKVNK
RNERGETPLHMAAIRGDVKQVKELISLGANVNVKDFAGWTPLHEACNVGYYDVAKILIAA
GADVNTQGLDDDTPLHDSASSGHRDIVKLLLRHGGNPFQANKHGERPVDVAETEELELLL
KREVPLSDDDESYTDSEEAQSVNPSSVDENIDSETEKDSLICESKQILPSKTPLPSALDE
YEFKDDDDEEINKMIDDRHILRKEQRKENEPEAEKTHLFAKQEKAFYPKSFKSKKQKPSR
VLYSSTESSDEEALQNKKISTSCSVIPETSNSDIQTKKEYVVSGEHKQKGKVKRKLKNQN
KNKENQELKQEKEGKENTRITNLTVNTGLDCSEKTREEGNFRKSFSPKDDTSLHLFHIST
GKSPKHSCGLSEKQSTPLKQEHTKTCLSPGSSEMSLQPDLVRYDNTESEFLPESSSVKSC
KHKEKSKHQKDFHLEFGEKSNAKIKDEDHSPTFENSDCTLKKMDKEGKTLKKHKLKHKER
EKEKHKKEIEGEKEKYKTKDSAKELQRSVEFDREFWKENFFKSDETEDLFLNMEHESLTL
EKKSKLEKNIKDDKSTKEKHVSKERNFKEERDKIKKESEKSFREEKIKDLKEERENIPTD
KDSEFTSLGMSAIEESIGLHLVEKEIDIEKQEKHIKESKEKPEKRSQTKEKDIEKMERKN
FEKEKKIKHEHKSEKDKLDLSECVDKIKEKDKLYSHHTEKCHKEGEKSKNTAAIKKTDDR
EKSREKMDRKHDKEKPEKERHLAESKEKHLMEKKNKQSDNSEYSKSEKGKNKEKDRELDK
KEKSRDKESINITNSKHIQEEKKSSIVDGNKAQHEKPLSLKEKTKDEPLKTPDGKEKDKK
DKDIDRYKERDKHKDKIQINSLLKLKSEADKPKPKSSPASKDTRPKEKRLVNDDLMQTSF
ERMLSLKDLEIEQWHKKHKEKIKQKEKERLRNRNCLELKIKDKEKTKHTPTESKNKELTR
SKSSEVTDAYTKEKQPKDAVSNRSQSVDTKNVMTLGKSSFVSDNSLNRSPRSENEKPGLS
SRSVSMISVASSEDSCHTTVTTPRPPVEYDSDFMLESSESQMSFSQSPFLSIAKSPALHE
RELDSLADLPERIKPPYANRLSASHLRSSSVEDVKLIISEGRPTIEVRRCSMPSVICEHT
KQFQTISEESNQGSLLIVPRDTSPSPKPEVFSNVPERDLSNVSNIHSSFATSPTGASNSK
YVSADRNLIKNTAPVSTVMDSPVHLEPSSQVGVIQNKSWEMPVDRLETLSTRDYICPNSN
IPDQESSLQSFCNPENKILKENADFLSLRQTELPGNSCAQDPASFMPPQQPCSFPSQSLS
DAESISKHMSLSYVANQEPGILQQKNAVQIISSALDTDNESTKDTENTFVLGDVQKTDAF
VPVYSDSTIQEASPNFEKAYTLPVLPSEKDFNGSDASTQLNTHYAFSKLTYKSSSGHEVE
NSTTDTQVISHEKENKLESLVLTHLNRCDSDLCEMNAGMPKGNLNEQDPKHCPESEKCLL
SIEDEESQQSILSSLENHSQQSTQPEMHKYGQLVKVELEENAEDDKTENQIPQRMTRNKA
NTMANQSKQILASCTLLSEKDSESSSPRGRIRLTEDDDPQIHHPRKRKVSRVPQPVQVSP
SLLQAKEKTQQSLAAIVDSLKLDEIQPYSSERANPYFEYLHIRKKIEEKRKLLCSVIPQA
PQYYDEYVTFNGSYLLDGNPLSKICIPTITPPPSLSDPLKELFRQQEVVRMKLRLQHSIE
REKLIVSNEQEVLRVHYRAARTLANQTLPFSACTVLLDAEVYNVPLDSQSDDSKTSVRDR
FNARQFMSWLQDVDDKFDKLKTCLLMRQQHEAAALNAVQRLEWQLKLQELDPATYKSISI
YEIQEFYVPLVDVNDDFELTPI
NT seq 6189 nt   +upstreamnt  +downstreamnt
atgcccaaatctgggttcacaaaaccagttcagagtgaaaattctgacagtgacagcaat
atggtagagaaaccatatggaagaaagagtaaagacaagattgcatcctacagcaaaact
ccaaaaattgaacgaagtgatgtgagcaaggagatgaaagagaaatcatccatgaaacgt
aaacttccttttaccattagcccatcaagaaatgaagaacgagattcagacacagattca
gatccaggacatacaagtgaaaattggggggagagacttatatcttcttacaggacatac
tcagagaaagaaggtccagaaaagaagaagacaaaaaaggaagctggaaataagaaatcc
acaccagttagcattctttttggttatccactctctgagcgaaaacagatggcacttctt
atgcagatgacagcaagagacaacagtccagattccacaccaaatcatccatcacaaaca
acgcctgcccaaaagaaaactcccagttcttcatctcgacagaaagataaagttaataaa
agaaatgaacgtggtgaaactcctttacacatggctgctattcgaggagatgtgaaacaa
gttaaagaattaataagtttaggggcaaatgtgaatgtgaaagattttgcaggttggaca
ccactgcatgaagcttgcaatgttggatattacgatgttgctaagatacttatagcagct
ggagcagatgttaacacacaaggattagatgatgacactccactccatgattctgctagt
agtgggcacagagatatagtaaagctgttacttcgtcacggtggaaatccatttcaagct
aataaacatggggagcgtccagtggatgtagcagaaacagaggagttggagttgctacta
aaaagagaggtgcctttatctgatgatgatgaaagttacacagattccgaagaggctcaa
tctgtaaatccttctagtgttgatgaaaatattgactctgaaacagagaaagactctctc
atctgtgaaagtaaacagatacttcccagtaaaacacctcttccatctgcccttgatgag
tatgagttcaaagatgatgatgatgaagaaattaataagatgattgatgataggcatatt
cttaggaaagaacaacgaaaagaaaatgaacctgaagcagaaaaaactcatttatttgca
aaacaggagaaagccttctatcctaaatcatttaaaagtaaaaaacaaaagccatctagg
gtcttatattcaagtactgaaagttctgatgaagaagctcttcagaataaaaagatttct
acttcatgttccgtcatccctgaaacatcaaattctgatatacaaaccaaaaaggaatat
gtagtttcaggtgaacacaaacagaaaggcaaagttaaaagaaaattgaaaaatcagaat
aaaaacaaagagaaccaagagctaaagcaagaaaaggaaggaaaagaaaatacaagaata
acaaacttgacagtaaatactggactagattgttcagaaaagaccagagaggaggggaac
tttaggaaatcttttagcccaaaagatgatacttcattacatttatttcatatttccact
ggtaaatctcccaaacattcttgtggattaagtgaaaaacagtcaacaccactaaaacaa
gaacatactaaaacatgtttatcaccaggaagttctgaaatgtcattacagcctgatctt
gttcggtatgataatacagaatctgaattcttgccagaaagttcaagtgtaaaatcttgt
aagcataaggaaaaaagcaaacatcagaaagatttccacttagaatttggtgaaaaatca
aatgccaaaataaaggatgaagatcatagtccaacatttgaaaattcagattgcacactg
aaaaaaatggataaagaaggtaaaacattaaaaaaacataaattgaagcataaagagagg
gaaaaagaaaagcataaaaaagaaattgaaggtgaaaaggaaaaatacaaaactaaggat
agtgccaaagaactgcagaggagtgtggaatttgatagagaattttggaaagagaatttt
tttaaaagtgatgaaactgaagatctctttttaaatatggaacatgaatccttaacatta
gaaaaaaaatcaaaattggaaaaaaacatcaaagatgataaatcaaccaaggaaaagcat
gtgtcaaaagagaggaactttaaagaggaacgagacaagattaaaaaggaaagcgagaaa
tcttttagggaggaaaaaataaaagatctaaaagaagagagagaaaacatacccacagat
aaagactcagaatttacttctttgggtatgagtgccattgaggaatctatagggcttcat
ttagtggaaaaggaaatagacattgaaaaacaagaaaagcatataaaggaaagtaaagaa
aaacctgagaagcgatctcaaactaaagaaaaggacattgagaagatggaaagaaaaaac
tttgaaaaagaaaagaagataaaacatgagcataagtcagaaaaagacaaattagatctt
agtgaatgcgttgataaaataaaagaaaaggacaagctatattcgcatcacacagaaaaa
tgccataaagaaggtgagaagagcaaaaatactgctgctattaaaaaaactgacgacaga
gagaaaagtagagaaaagatggataggaaacatgacaaagaaaagcctgaaaaagagagg
catctagcagaaagcaaagaaaagcacttgatggagaaaaaaaataaacaatcagataat
agtgaatacagtaaatcagaaaaaggcaaaaataaagaaaaagacagggagctagataaa
aaggaaaaatctagagataaagaaagtataaatataactaactccaaacacatacaggaa
gaaaaaaaatcaagtatagtagacggtaataaagcacaacatgaaaaacccttatccctt
aaagaaaaaacaaaagatgaacctttgaaaactccagatggaaaagaaaaagataaaaaa
gataaagatatagatagatacaaagaacgagacaaacataaagataaaattcaaataaat
agcttactcaaactaaaatctgaagcagataagcctaaacctaagtcatcaccagcatca
aaagatacccggcctaaagaaaagaggttagtgaatgatgatttaatgcagacaagtttt
gaacgaatgctaagccttaaagacctagaaatagaacagtggcacaaaaaacataaggaa
aaaattaagcaaaaagaaaaagaacggttgagaaaccgaaactgtttagaacttaaaata
aaagataaagaaaaaacaaagcatacaccaactgaatccaaaaataaagaacttactagg
tcaaagagttcagaagtgactgatgcatataccaaggagaaacaacctaaagatgctgta
agtaacagatcacaatctgttgacaccaaaaatgtaatgactttagggaagtcatctttt
gtttcagataatagcttaaacaggtctcctagatcagaaaatgaaaagccgggtctcagc
tccagatctgtatccatgatttctgttgctagttcagaagattcctgccatactacagtg
acaaccccaaggcctccagttgagtatgactctgactttatgttagagagttcagaatcc
caaatgtccttttcccagtcaccttttttgtcaattgccaaatctcctgctcttcatgaa
agggaattggacagcctggctgacttgccggagcggattaaaccaccatatgcaaacaga
ctttcagcatcccatcttaggtcatcttctgtagaagatgttaaactaattataagcgag
gggagacctaccatagaagttcgaagatgtagcatgccttctgtcatttgtgaacatacc
aaacaattccaaacaatatcagaagagagcaatcaaggtagcttattaattgtgccaaga
gatactagtccttctcccaaacctgaggtattctcaaatgtgcctgaaagagacctttca
aatgtatctaacatacattccagttttgcaacttctccaactggagcttcaaacagcaaa
tatgtttcagctgatagaaatctcatcaagaatactgccccagtgagcactgtaatggac
agtccagtgcatttagagccatctagtcaggttggtgtgatccagaataagtcatgggag
atgcctgttgatagactagagacattaagcaccagagactatatctgcccaaattctaac
atacctgatcaagaatcctctcttcagagtttttgtaatcctgaaaataagatattgaaa
gaaaatgctgattttttatccctgcgccagactgaactgccaggaaactcttgtgctcag
gatccggcatcctttatgcctccacagcagccttgctctttccccagccaatcactttca
gatgctgaatcgatttctaaacatatgtctttgtcatatgttgctaatcaagagccaggt
attttacaacaaaaaaatgcagttcagattattagttctgctttagatactgataatgaa
tctacaaaagatacagaaaatacttttgtcctaggagatgttcaaaaaacagatgccttt
gtcccagtgtactctgacagcactattcaagaagcatcaccaaactttgagaaagcttat
actttacctgtgttaccatcagaaaaggactttaatggaagtgatgcctctacccagcta
aatacacattatgcatttagcaaactaacttacaagtcttccagtggccatgaagttgag
aatagcacaactgatactcaggtcatttcacatgaaaaagaaaacaaactggagagtttg
gttttaactcatttgaataggtgtgattctgatttatgtgaaatgaatgcagggatgcca
aaaggaaacctaaatgaacaagatccaaaacattgtcctgaaagtgaaaagtgtttgctt
tccatagaagatgaggaatctcaacaaagcattttatcaagtctggaaaaccattcacag
cagtcaactcaaccagaaatgcataaatatggtcagttagttaaagtagaattagaagaa
aatgccgaagatgataaaactgaaaaccaaatccctcaaagaatgactagaaacaaagca
aatacaatggcaaatcaaagcaaacagattcttgctagctgtacactattatcagaaaaa
gacagtgaatcctcatctcctagaggaagaataagattaactgaagatgacgatcctcaa
attcaccatccacggaaaaggaaagtgtcacgtgtacctcagcctgtgcaagtgagtccc
tctttactacaagcaaaagagaaaactcagcaatctctggcagccattgtagattctcta
aaactagatgagattcagccatacagttcagagagagcaaatccatattttgaatacttg
cacataaggaaaaaaatagaagaaaaacgcaaattactgtgtagtgtgattcctcaagca
cctcagtactatgacgaatatgtaacatttaacggatcatatctcctggatggaaacccc
ttaagcaagatttgtattcccacaattacaccaccaccttcactgtcagatccacttaaa
gagctttttcgacaacaggaagttgtaaggatgaaactacgtttgcaacacagtattgaa
agggaaaaactcattgtatccaacgaacaagaagttttgcgagttcattacagagctgca
agaacattggcaaatcaaacactgccatttagtgcttgtactgttttgctggatgccgaa
gtatacaatgtaccgttggactctcagtctgatgacagtaaaacttctgtgagggatcgc
tttaatgcaagacaattcatgtcttggttacaagatgtggatgataaatttgacaaatta
aagacctgtcttttaatgaggcaacaacatgaagctgcggctttaaatgctgtccagagg
ttagaatggcagctcaaactccaggaacttgatcctgccacctataaatctatcagcatt
tacgaaatccaggagttttatgttccccttgttgatgttaacgacgactttgaattgact
cctatatag

DBGET integrated database retrieval system