KEGG   Pan troglodytes (chimpanzee): 474107
Entry
474107            CDS       T01005                                 

Gene name
SIM2
Definition
(RefSeq) single-minded homolog 2 isoform X1
  KO
K09100  single-minded
Organism
ptr  Pan troglodytes (chimpanzee)
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ptr03000]
    474107 (SIM2)
Transcription factors [BR:ptr03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    474107 (SIM2)
SSDB
Motif
Pfam: SIM_C PAS_3 PAS_11 PAS HLH PAS_9 PAS_4
Other DBs
NCBI-GeneID: 474107
NCBI-ProteinID: XP_001169453
Ensembl: ENSPTRG00000013894
VGNC: 10507
UniProt: A0A6D2XA88 A0A2I3TNB0
Position
21
AA seq 667 aa
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGL
GDAWGQPSRAGPLDSVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPSDHDEMTAVLTAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGY
KVIHCSGYLKIRQYMLDMSLYDSCYQIVGLVAVGQSLPPSAITEIKLYSNMFMFRASLDL
KLIFLDSRVTEVTGYEPQDLIEKTLYHHVHGCDVFHLRYAHHLLLVKGQVTTKYYRLLSK
RGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTEIEYKELQLSLEQVSTAKSQDSWRTAL
STSQETRKLVKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECGQLGNWRASPPASAAAPPE
PQLHSESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFL
STLPASGECQWHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYEAPAAAVRRFGEDTAP
PSFPSCGHYREEPALGPAKAARQAARDGARLALARAAPECCAPPTPEAPGAPAQLPFVLL
NYHRVLARRGPLGGAAPAASGLACAPGGPEAATGALRLRHPSPAATSPPGAPLPHYLGAS
VIITNGR
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgaaggagaagtccaagaatgcggccaagaccaggagggagaaggaaaatggcgagttt
tacgagcttgccaagctgctcccgctgccgtcggccatcacctcgcagctggacaaagcg
tccatcatccgcctcaccacgagctacctgaagatgcgcgccgtcttccccgaaggttta
ggagacgcgtggggacagccgagccgcgccgggcccctggacagcgtcgccaaggagctg
ggatcgcacttgctgcagactttggatggatttgtttttgtggtagcatctgatggcaaa
atcatgtatatatccgagaccgcttctgtccatttaggcttgtcccaggtggagctcacg
ggcaacagtatttatgaatacatccatccttccgaccacgatgagatgaccgctgtcctc
acggcccaccagccgctgcaccaccacctgctccaagagtatgagatagagaggtcgttc
tttcttcgaatgaaatgtgtcttggcgaaaaggaacgcgggcctgacctgcagcggatac
aaggtcatccactgcagtggctacttgaagatcaggcagtatatgctggacatgtccctg
tacgactcctgctaccagattgtggggctggtggccgtgggccagtcgctgccacccagt
gccatcaccgagatcaagctgtacagtaacatgttcatgttcagggccagcctcgacctg
aagctgatattcctggattccagggtgaccgaggtgacggggtacgagccgcaggacctg
atcgagaagaccctataccatcacgtgcacggctgcgacgtgttccacctccgctacgca
caccacctcctgttggtgaagggccaggtcaccaccaagtactaccggctgctgtccaag
cggggcggctgggtgtgggtgcagagctacgccaccgtggtgcacaacagccgctcgtcc
cggccccactgcatcgtgagtgtcaattatgtactcacggagattgaatacaaggaactt
cagctgtccctggagcaggtgtccactgccaagtcccaggactcctggaggaccgccttg
tctacctcacaagaaactaggaaattagtgaaacccaaaaataccaagatgaagacaaag
ctgagaacaaacccttaccccccacagcaatacagctcgttccaaatggacaaactggaa
tgcggccagctcggaaactggagagccagtcctcctgcaagcgctgctgctcctccagaa
ccgcagctccactcagaaagcagtgaccttctgtacacgccatcctacagcctgcccttc
tcctaccattacggacacttccctctggactctcacgtcttcagcagcaaaaagccaatg
ttgccggccaagttcgggcagccccaaggatccccttgtgaggtggcacgctttttcctg
agcacactgccagccagcggtgaatgccagtggcattatgccaaccccctagtgcctagc
agctcgtctccagctaaaaatcctccggagccaccggcaaacactgctaggcacagcctg
gtgccaagctacgaagcgcccgccgccgccgtgcgcaggttcggcgaggacaccgcgccc
ccgagtttcccgagctgcggccactaccgcgaggagcccgcgctgggcccggccaaagcc
gcccgccaggccgcccgggacggggcgcggctggcgctggcccgcgcggcacccgagtgc
tgcgcgcccccgacccccgaggccccgggcgcgccggcgcagctgcccttcgtgctgctc
aactaccaccgcgtgctggcccggcgcggaccgctggggggcgccgcacccgccgcctcc
ggcctggcctgcgctcccggcggccccgaggcggcgaccggcgcgctgcggctccggcac
ccgagccccgccgccacctccccgcccggcgcgcccctgccgcactacctgggcgcctcg
gtcatcatcaccaacgggaggtga

DBGET integrated database retrieval system