KEGG   Pan troglodytes (chimpanzee): 741949
Entry
741949            CDS       T01005                                 

Gene name
APLN
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
ptr  Pan troglodytes (chimpanzee)
Pathway
ptr04080  Neuroactive ligand-receptor interaction
ptr04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:ptr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    741949 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    741949 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 741949
NCBI-ProteinID: XP_016799545
UniProt: A0A2J8LE97
Position
X
AA seq 77 aa
MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggctctgcgtgcaggcgctcctgctgctctggctctccttgaccgcggtg
tgtggagggtccctgatgccgcttcccgatgggaatgggctggaagacggcaatgtccgc
cacctggtgcagcccagagggtcaaggaatgggccagggccctggcagggaggtcggagg
aaattccgccgccagcggccccgcctctcccataagggacccatgcctttctga

DBGET integrated database retrieval system